GABARAPL2 Antikörper

Produktnummer ABIN631966

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch GABARAPL2 in WB. Es zeigt Reaktivität gegenüber Proben von Human, Maus und Ratte.

Kurzübersicht für GABARAPL2 Antikörper (ABIN631966)

Target: GABARAPL2 (GABA(A) Receptor-Associated Protein-Like 2 (GABARAPL2))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser GABARAPL2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-GABARAPL2 Antikörper

Aufreinigung: Affinity purified

Immunogen: GABARAPL2 antibody was raised using a synthetic peptide corresponding to a region with amino acids KWMFKEDHSLEHRCVESAKIRAKYPDRVPVIVEKVSGSQIVDIDKRKYLV

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

GABARAPL2 Blocking Peptide, (ABIN940117), is also available for use as a blocking control in assays to test for specificity of this GABARAPL2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GABARAPL2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu GABARAPL2

Target: GABARAPL2 (GABA(A) Receptor-Associated Protein-Like 2 (GABARAPL2))

Andere Bezeichnung: GABARAPL2

Hintergrund: GABARAPL2 belongs to the MAP1 LC3 family. It modulates intra-Golgi transport through coupling between NSF activity and SNAREs activation. The protein first stimulates the ATPase activity of NSF which in turn stimulates the association with GOSR1.

Molekulargewicht: 14 kDa (MW of target protein)

Pathways: Autophagie