GABARAPL2 Antikörper

Produktnummer ABIN631966

Produktdetails anti-GABARAPL2 Antikörper

Target: GABARAPL2 (GABA(A) Receptor-Associated Protein-Like 2 (GABARAPL2))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser GABARAPL2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: GABARAPL2 antibody was raised using a synthetic peptide corresponding to a region with amino acids KWMFKEDHSLEHRCVESAKIRAKYPDRVPVIVEKVSGSQIVDIDKRKYLV

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

GABARAPL2 Blocking Peptide, catalog no. 33R-4731, is also available for use as a blocking control in assays to test for specificity of this GABARAPL2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GABARAPL2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu GABARAPL2

Target: GABARAPL2 (GABA(A) Receptor-Associated Protein-Like 2 (GABARAPL2))

Andere Bezeichnung: GABARAPL2 (GABARAPL2 Produkte)

Synonyme: GABARAPL2 antikoerper, atg8 antikoerper, gef2 antikoerper, gate16 antikoerper, gate-16 antikoerper, Gef2 antikoerper, ATG8 antikoerper, ATG8C antikoerper, GATE-16 antikoerper, GATE16 antikoerper, GEF-2 antikoerper, GEF2 antikoerper, zgc:92319 antikoerper, 0610012F20Rik antikoerper, 2900019O08Rik antikoerper, AI173605 antikoerper, GABA type A receptor associated protein like 2 antikoerper, GABA(A) receptor-associated protein like 2 antikoerper, GABA(A) receptor-associated protein like 2 L homeolog antikoerper, gamma-aminobutyric acid (GABA) A receptor-associated protein-like 2 antikoerper, GABARAPL2 antikoerper, gabarapl2 antikoerper, Gabarapl2 antikoerper, gabarapl2.L antikoerper

Hintergrund: GABARAPL2 belongs to the MAP1 LC3 family. It modulates intra-Golgi transport through coupling between NSF activity and SNAREs activation. The protein first stimulates the ATPase activity of NSF which in turn stimulates the association with GOSR1.

Molekulargewicht: 14 kDa (MW of target protein)

Pathways: Autophagie