CYP26B1 Antikörper (Middle Region)

Produktnummer ABIN631961

Produktdetails anti-CYP26B1 Antikörper

Target: CYP26B1 (Cytochrome P450, Family 26, Subfamily B, Polypeptide 1 (CYP26B1))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CYP26B1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: CYP26 B1 antibody was raised against the middle region of CYP26 1

Aufreinigung: Affinity purified

Immunogen: CYP26 B1 antibody was raised using the middle region of CYP26 1 corresponding to a region with amino acids SRFELATRTFPRITLVPVLHPVDGLSVKFFGLDSNQNEILPETEAMLSAT

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CYP26B1 Blocking Peptide, catalog no. 33R-8748, is also available for use as a blocking control in assays to test for specificity of this CYP26B1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CYP20 1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CYP26B1

Target: CYP26B1 (Cytochrome P450, Family 26, Subfamily B, Polypeptide 1 (CYP26B1))

Andere Bezeichnung: CYP26B1 (CYP26B1 Produkte)

Synonyme: cyp26b1 antikoerper, cyp26a2 antikoerper, p450rai-2 antikoerper, CYP26A2 antikoerper, P450RAI-2 antikoerper, P450RAI2 antikoerper, RHFCA antikoerper, CP26 antikoerper, fc21d03 antikoerper, wu:fc21d03 antikoerper, wu:fc26h10 antikoerper, zgc:76999 antikoerper, cytochrome P450 26B1 antikoerper, cytochrome P450 family 26 subfamily B member 1 L homeolog antikoerper, cytochrome P450 family 26 subfamily B member 1 antikoerper, cytochrome P450, family 26, subfamily B, polypeptide 1 antikoerper, cytochrome P450, family 26, subfamily b, polypeptide 1 antikoerper, CpipJ_CPIJ002537 antikoerper, cyp26b1.L antikoerper, CYP26B1 antikoerper, cyp26b1 antikoerper, Cyp26b1 antikoerper

Hintergrund: This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases that catalyze many reactions involved in drug metabolism and the synthesis of cholesterol, steroids and other lipids. The enzyme encoded by this gene is involved in the specific inactivation of all-trans-retinoic acid to hydroxylated forms, such as 4-oxo-, 4-OH-, and 18-OH-all-trans-retinoic acid.

Molekulargewicht: 57 kDa (MW of target protein)

Pathways: Retinoic Acid Receptor Signaling Pathway, Regulation of Muscle Cell Differentiation, Monocarboxylic Acid Catabolic Process