YTHDF3 Antikörper (N-Term)
-
- Target Alle YTHDF3 Antikörper anzeigen
- YTHDF3 (YTH Domain Family, Member 3 (YTHDF3))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser YTHDF3 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- YTHDF3 antibody was raised against the N terminal of YTHDF3
- Aufreinigung
- Affinity purified
- Immunogen
- YTHDF3 antibody was raised using the N terminal of YTHDF3 corresponding to a region with amino acids GEAAWSTAGDQPMPYLTTYGQMSNGEHHYIPDGVFSQPGALGNTPPFLGQ
- Top Product
- Discover our top product YTHDF3 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
YTHDF3 Blocking Peptide, catalog no. 33R-3217, is also available for use as a blocking control in assays to test for specificity of this YTHDF3 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of YTHDF3 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- YTHDF3 (YTH Domain Family, Member 3 (YTHDF3))
- Andere Bezeichnung
- YTHDF3 (YTHDF3 Produkte)
- Synonyme
- wu:fi35c09 antikoerper, zgc:55441 antikoerper, 9130022A11Rik antikoerper, YTH N6-methyladenosine RNA binding protein 3 antikoerper, YTH N(6)-methyladenosine RNA binding protein 3 antikoerper, YTH domain family 3 antikoerper, YTH N6-methyladenosine RNA binding protein 3 S homeolog antikoerper, ythdf3 antikoerper, YTHDF3 antikoerper, Ythdf3 antikoerper, ythdf3.S antikoerper
- Hintergrund
- YTHDF3 contains 1 YTH domain. The functions of YTHDF3 remain unknown.
- Molekulargewicht
- 64 kDa (MW of target protein)
-