TSGA13 Antikörper (Middle Region)
-
- Target Alle TSGA13 Produkte
- TSGA13 (Testis Specific, 13 (TSGA13))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser TSGA13 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- TSGA13 antibody was raised against the middle region of TSGA13
- Aufreinigung
- Affinity purified
- Immunogen
- TSGA13 antibody was raised using the middle region of TSGA13 corresponding to a region with amino acids ASERPISKVIREPLTLASLLEDMPTRTAPGESAFRNGRAPQWIIKKATVI
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
TSGA13 Blocking Peptide, catalog no. 33R-1503, is also available for use as a blocking control in assays to test for specificity of this TSGA13 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TSGA13 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TSGA13 (Testis Specific, 13 (TSGA13))
- Andere Bezeichnung
- TSGA13 (TSGA13 Produkte)
- Synonyme
- 1700023D02Rik antikoerper, Vme1 antikoerper, testis specific gene A13 antikoerper, testis specific 13 antikoerper, Tsga13 antikoerper, TSGA13 antikoerper
- Hintergrund
- The specific function of TSGA13 is not yet known.
- Molekulargewicht
- 32 kDa (MW of target protein)
-