TSGA13 Antikörper (Middle Region)

Produktnummer ABIN631851

Produktdetails anti-TSGA13 Antikörper

Target: TSGA13 (Testis Specific, 13 (TSGA13))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TSGA13 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: TSGA13 antibody was raised against the middle region of TSGA13

Aufreinigung: Affinity purified

Immunogen: TSGA13 antibody was raised using the middle region of TSGA13 corresponding to a region with amino acids ASERPISKVIREPLTLASLLEDMPTRTAPGESAFRNGRAPQWIIKKATVI

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TSGA13 Blocking Peptide, catalog no. 33R-1503, is also available for use as a blocking control in assays to test for specificity of this TSGA13 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TSGA13 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TSGA13

Target: TSGA13 (Testis Specific, 13 (TSGA13))

Andere Bezeichnung: TSGA13 (TSGA13 Produkte)

Synonyme: 1700023D02Rik antikoerper, Vme1 antikoerper, testis specific gene A13 antikoerper, testis specific 13 antikoerper, Tsga13 antikoerper, TSGA13 antikoerper

Hintergrund: The specific function of TSGA13 is not yet known.

Molekulargewicht: 32 kDa (MW of target protein)