FBXW8 Antikörper (Middle Region)

Produktnummer ABIN631825

Produktdetails anti-FBXW8 Antikörper

Target: FBXW8 (F-Box and WD Repeat Domain Containing 8 (FBXW8))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser FBXW8 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: FBXW8 antibody was raised against the middle region of FBXW8

Aufreinigung: Affinity purified

Immunogen: FBXW8 antibody was raised using the middle region of FBXW8 corresponding to a region with amino acids MNQKLWEVYSGHPVQHISFSSHSLITANVPYQTVMRNADLDSFTTHRRHR

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

FBXW8 Blocking Peptide, catalog no. 33R-6260, is also available for use as a blocking control in assays to test for specificity of this FBXW8 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FBXW8 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu FBXW8

Target: FBXW8 (F-Box and WD Repeat Domain Containing 8 (FBXW8))

Andere Bezeichnung: FBXW8 (FBXW8 Produkte)

Synonyme: FBW6 antikoerper, FBW8 antikoerper, FBX29 antikoerper, FBXO29 antikoerper, FBXW6 antikoerper, 4930438M06Rik antikoerper, Fbx29 antikoerper, F-box and WD repeat domain containing 8 antikoerper, ring finger protein, transmembrane 2 antikoerper, F-box and WD-40 domain protein 8 antikoerper, FBXW8 antikoerper, Fbxw8 antikoerper, RNFT2 antikoerper

Hintergrund: FBXW8 is a member of the F-box protein family, members of which are characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into three classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. FBXW8 contains a WD-40 domain, in addition to an F-box motif, so it belongs to the Fbw class.

Molekulargewicht: 67 kDa (MW of target protein)