CAD Antikörper (Middle Region)

Produktnummer ABIN631789

Produktdetails anti-CAD Antikörper

Target: CAD (Carbamoyl-Phosphate Synthetase 2, Aspartate Transcarbamylase, and Dihydroorotase (CAD))

Bindungsspezifität: Middle Region

Reaktivität: Drosophila melanogaster

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CAD Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: CAD antibody was raised against the middle region of CAD

Aufreinigung: Affinity purified

Immunogen: CAD antibody was raised using the middle region of CAD corresponding to a region with amino acids SVSNNNRTSPSKPPYFDWMKKPAYPAQPQPGKTRTKDKYRVVYTDFQRLE

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CAD Blocking Peptide, catalog no. 33R-8934, is also available for use as a blocking control in assays to test for specificity of this CAD antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CAD antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CAD

Target: CAD (Carbamoyl-Phosphate Synthetase 2, Aspartate Transcarbamylase, and Dihydroorotase (CAD))

Andere Bezeichnung: CAD (CAD Produkte)

Synonyme: Cpad antikoerper, AU018859 antikoerper, 2410008J01Rik antikoerper, cb456 antikoerper, wu:fc30c12 antikoerper, wu:fc33d01 antikoerper, wu:fc67g02 antikoerper, si:dkey-221h15.3 antikoerper, CAD antikoerper, xcad antikoerper, carbamoyl-phosphate synthetase 2, aspartate transcarbamylase, and dihydroorotase antikoerper, CAD antikoerper, Cad antikoerper, cad antikoerper

Hintergrund: Cad regulates embryonic abdominal segment formation by zygotically activating expression of knirps (kni) and giant (gt). It plays a role in the establishment of the hindgut and in the invagination of the hindgut primordium during gastrulation. These effects on the gut are achieved by acting combinatorially at the posterior of the embryo to activate transcription of different targets, including folded gastrulation (fog), fork head (fkh) and wingless (wg).

Molekulargewicht: 46 kDa (MW of target protein)

Pathways: Production of Molecular Mediator of Immune Response, Ribonucleoside Biosynthetic Process