CRBN Antikörper (N-Term)
-
- Target Alle CRBN Antikörper anzeigen
- CRBN (Cereblon (CRBN))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser CRBN Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- CRBN antibody was raised against the N terminal of CRBN
- Aufreinigung
- Affinity purified
- Immunogen
- CRBN antibody was raised using the N terminal of CRBN corresponding to a region with amino acids DQDSKEAKKPNIINFDTSLPTSHTYLGADMEEFHGRTLHDDDSCQVIPVL
- Top Product
- Discover our top product CRBN Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
CRBN Blocking Peptide, catalog no. 33R-2125, is also available for use as a blocking control in assays to test for specificity of this CRBN antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CRBN antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CRBN (Cereblon (CRBN))
- Andere Bezeichnung
- CRBN (CRBN Produkte)
- Synonyme
- zgc:92404 antikoerper, mrt2a antikoerper, F3N11.21 antikoerper, MRT2 antikoerper, MRT2A antikoerper, 2610203G15Rik antikoerper, 2900045O07Rik antikoerper, AF229032 antikoerper, AW108261 antikoerper, piL antikoerper, cereblon antikoerper, ATP-dependent protease La (LON) domain protein antikoerper, crbn antikoerper, CRBN antikoerper, AT2G25740 antikoerper, Crbn antikoerper
- Hintergrund
- This gene encodes a protein related to the Lon protease protein family. In rodents and other mammals this gene product is found in the cytoplasm localized with a calcium channel membrane protein, and is thought to play a role in brain development.
- Molekulargewicht
- 50 kDa (MW of target protein)
-