SAR1B Antikörper

Produktnummer ABIN631740

Der Kaninchen Polyklonal anti-SAR1B Antikörper (ABIN631740) detektiert spezifisch SAR1B in WB. Dieser Antikörper reagiert spezifisch mit Proben aus Human, Maus und Ratte.

Kurzübersicht für SAR1B Antikörper (ABIN631740)

Target: SAR1B (SAR1 Homolog B (SAR1B))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SAR1B Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-SAR1B Antikörper

Aufreinigung: Affinity purified

Immunogen: SAR1 B antibody was raised using a synthetic peptide corresponding to a region with amino acids RLLESKEELDSLMTDETIANVPILILGNKIDRPEAISEERLREMFGLYGQ

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SAR1B Blocking Peptide, (ABIN5615997), is also available for use as a blocking control in assays to test for specificity of this SAR1B antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SAR0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SAR1B

Target: SAR1B (SAR1 Homolog B (SAR1B))

Andere Bezeichnung: SAR1B

Hintergrund: SAR1B is involved in transport from the endoplasmic reticulum to the Golgi apparatus. SAR1B is activated by the guanine nucleotide exchange factor PREB. SAR1B is involved in the selection of the protein cargo and the assembly of the COPII coat complex.

Molekulargewicht: 22 kDa (MW of target protein)

Pathways: Lipid Metabolism