SAR1B Antikörper
-
- Target Alle SAR1B Antikörper anzeigen
- SAR1B (SAR1 Homolog B (SAR1B))
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser SAR1B Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- SAR1 B antibody was raised using a synthetic peptide corresponding to a region with amino acids RLLESKEELDSLMTDETIANVPILILGNKIDRPEAISEERLREMFGLYGQ
- Top Product
- Discover our top product SAR1B Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
SAR1B Blocking Peptide, catalog no. 33R-8038, is also available for use as a blocking control in assays to test for specificity of this SAR1B antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SAR0 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SAR1B (SAR1 Homolog B (SAR1B))
- Andere Bezeichnung
- SAR1B (SAR1B Produkte)
- Synonyme
- SAR1 antikoerper, SAR1B antikoerper, SARA2 antikoerper, 2310075M17Rik antikoerper, 2900019I22Rik antikoerper, CMRD antikoerper, Sara1b antikoerper, Sara2 antikoerper, Sarb antikoerper, cmrd antikoerper, gtbpb antikoerper, sar1a antikoerper, sara2 antikoerper, SARA1B antikoerper, ANDD antikoerper, GTBPB antikoerper, zgc:73204 antikoerper, secretion associated Ras related GTPase 1B antikoerper, hypothetical protein antikoerper, SAR1 homolog B (S. cerevisiae) antikoerper, secretion associated, Ras related GTPase 1B L homeolog antikoerper, secretion associated, Ras related GTPase 1B antikoerper, SAR1B antikoerper, Sar1B antikoerper, sar1b antikoerper, Sar1b antikoerper, sar1b.L antikoerper
- Hintergrund
- SAR1B is involved in transport from the endoplasmic reticulum to the Golgi apparatus. SAR1B is activated by the guanine nucleotide exchange factor PREB. SAR1B is involved in the selection of the protein cargo and the assembly of the COPII coat complex.
- Molekulargewicht
- 22 kDa (MW of target protein)
- Pathways
- Lipid Metabolism
-