UCHL3 Antikörper
-
- Target Alle UCHL3 (Uchl3) Antikörper anzeigen
- UCHL3 (Uchl3) (Ubiquitin Carboxyl-terminal Esterase L3 (Ubiquitin Thiolesterase) (Uchl3))
-
Reaktivität
- Human, Ratte, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser UCHL3 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- UCHL3 antibody was raised using a synthetic peptide corresponding to a region with amino acids MEGQRWLPLEANPEVTNQFLKQLGLHPNWQFVDVYGMDPELLSMVPRPVC
- Top Product
- Discover our top product Uchl3 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
UCHL3 Blocking Peptide, catalog no. 33R-5920, is also available for use as a blocking control in assays to test for specificity of this UCHL3 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UCHL3 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- UCHL3 (Uchl3) (Ubiquitin Carboxyl-terminal Esterase L3 (Ubiquitin Thiolesterase) (Uchl3))
- Andere Bezeichnung
- UCHL3 (Uchl3 Produkte)
- Synonyme
- UCH-L3 antikoerper, UCH-6 antikoerper, RGD1561196 antikoerper, im:6908825 antikoerper, zgc:109963 antikoerper, uchl4 antikoerper, ubiquitin C-terminal hydrolase L3 antikoerper, ubiquitin carboxyl-terminal esterase L3 (ubiquitin thiolesterase) antikoerper, ubiquitin C-terminal hydrolase L3 L homeolog antikoerper, UCHL3 antikoerper, Uchl3 antikoerper, uchl3 antikoerper, uchl3.L antikoerper
- Hintergrund
- UCHL3 is an ubiquitin-protein hydrolase involved both in the processing of ubiquitin precursors and of ubiquitinated proteins. This enzyme is a thiol protease that recognises and hydrolyzes a peptide bond at the C-terminal glycine of either ubiquitin or NEDD8.
- Molekulargewicht
- 25 kDa (MW of target protein)
- Pathways
- Feeding Behaviour, Positive Regulation of fat Cell Differentiation
-