NR4A3 Antikörper (Middle Region)

Produktnummer ABIN631676

Produktdetails anti-NR4A3 Antikörper

Target: NR4A3 (Nuclear Receptor Subfamily 4, Group A, Member 3 (NR4A3))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser NR4A3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: NR4 A3 antibody was raised against the middle region of NR4 3

Aufreinigung: Affinity purified

Immunogen: NR4 A3 antibody was raised using the middle region of NR4 3 corresponding to a region with amino acids KCLSVGMVKEVVRTDSLKGRRGRLPSKPKSPLQQEPSQPSPPSPPICMMN

Anwendungsinformationen

Applikationshinweise: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

NR4A3 Blocking Peptide, catalog no. 33R-4272, is also available for use as a blocking control in assays to test for specificity of this NR4A3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NR0 3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu NR4A3

Target: NR4A3 (Nuclear Receptor Subfamily 4, Group A, Member 3 (NR4A3))

Andere Bezeichnung: NR4A3 (NR4A3 Produkte)

Synonyme: CHN antikoerper, CSMF antikoerper, MINOR antikoerper, NOR1 antikoerper, TEC antikoerper, AI573420 antikoerper, NOR-1 antikoerper, Nor1 antikoerper, NOR-2 antikoerper, NR4A3 antikoerper, Nr4a3 antikoerper, nuclear receptor subfamily 4 group A member 3 antikoerper, nuclear receptor subfamily 4, group A, member 3 antikoerper, NR4A3 antikoerper, Nr4a3 antikoerper, nr4a3 antikoerper

Hintergrund: NR4A3 is a member of the steroid-thyroid hormone-retinoid receptor superfamily. NR4A3 may act as a transcriptional activator. The protein can efficiently bind the NGFI-B Response Element (NBRE). Three different versions of extraskeletal myxoid chondrosarcomas (EMCs) are the result of reciprocal translocations between NR4A3 gene and other genes.

Molekulargewicht: 64 kDa (MW of target protein)

Pathways: Fc-epsilon Rezeptor Signalübertragung, Nuclear Receptor Transcription Pathway, Steroid Hormone Mediated Signaling Pathway