ACTN3 Antikörper (N-Term)

Produktnummer ABIN631674

Produktdetails anti-ACTN3 Antikörper

Target: ACTN3 (Actinin, alpha 3 (ACTN3))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ACTN3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: Alpha Actinin 3 antibody was raised against the N terminal of ACTN3

Aufreinigung: Affinity purified

Immunogen: alpha Actinin 3 antibody was raised using the N terminal of ACTN3 corresponding to a region with amino acids VQNFHTSWKDGLALCALIHRHRPDLIDYAKLRKDDPIGNLNTAFEVAEKY

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Alpha Actinin 3 Blocking Peptide, catalog no. 33R-9753, is also available for use as a blocking control in assays to test for specificity of this Alpha Actinin 3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACTN3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ACTN3

Target: ACTN3 (Actinin, alpha 3 (ACTN3))

Andere Bezeichnung: alpha Actinin 3 (ACTN3 Produkte)

Synonyme: CG8953 antikoerper, Dmel\\CG8953 antikoerper, ORF1 antikoerper, acta-3 antikoerper, dabp antikoerper, ACTN2 antikoerper, actn3 antikoerper, actnl antikoerper, zgc:63559 antikoerper, fb95c03 antikoerper, wu:fb95c03 antikoerper, wu:fc11d03 antikoerper, zgc:77243 antikoerper, actinin alpha 3 (gene/pseudogene) antikoerper, actinin alpha 3 antikoerper, alpha actinin 3 antikoerper, actinin alpha 3a antikoerper, actinin alpha 3 (gene/pseudogene) L homeolog antikoerper, alpha-actinin-3 antikoerper, actinin alpha 3b antikoerper, ACTN3 antikoerper, Actn3 antikoerper, actn3a antikoerper, actn3.L antikoerper, actn3 antikoerper, LOC100439754 antikoerper, actn3b antikoerper

Hintergrund: Alpha-actinin is an actin-binding protein with multiple roles in different cell types. This protein expression is limited to skeletal muscle. It is localized to the Z-disc and analogous dense bodies, where it helps to anchor the myofibrillar actin filaments.

Molekulargewicht: 103 kDa (MW of target protein)

Pathways: Cell-Cell Junction Organization