Nitrilase 1 Antikörper (N-Term)
-
- Target Alle Nitrilase 1 (NIT1) Antikörper anzeigen
- Nitrilase 1 (NIT1)
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser Nitrilase 1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- NIT1 antibody was raised against the N terminal of NIT1
- Aufreinigung
- Affinity purified
- Immunogen
- NIT1 antibody was raised using the N terminal of NIT1 corresponding to a region with amino acids VREAARLGACLAFLPEAFDFIARDPAETLHLSEPLGGKLLEEYTQLAREC
- Top Product
- Discover our top product NIT1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
NIT1 Blocking Peptide, catalog no. 33R-9770, is also available for use as a blocking control in assays to test for specificity of this NIT1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NIT1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Nitrilase 1 (NIT1)
- Andere Bezeichnung
- NIT1 (NIT1 Produkte)
- Synonyme
- MGC85476 antikoerper, zgc:101630 antikoerper, ZmNIT1 antikoerper, DDBDRAFT_0217173 antikoerper, DDBDRAFT_0302491 antikoerper, DDB_0217173 antikoerper, DDB_0302491 antikoerper, AI255805 antikoerper, ESTM30 antikoerper, W57327 antikoerper, A. THALIANA NITRILASE 1 antikoerper, ATNIT1 antikoerper, NITI antikoerper, NITRILE AMINOHYDROLASE antikoerper, nitrilase 1 antikoerper, nitrilase 1 S homeolog antikoerper, nitrilase 1 antikoerper, nit1.S antikoerper, nit1 antikoerper, NIT1 antikoerper, nit1-2 antikoerper, Nit1 antikoerper
- Hintergrund
- NIT1 play a role in cell growth and apoptosis: loss of expression promotes cell growth and resistance to DNA damage stress.
- Molekulargewicht
- 36 kDa (MW of target protein)
-