GNL3L Antikörper

Produktnummer ABIN631615

Produktdetails anti-GNL3L Antikörper

Target: GNL3L (Guanine Nucleotide Binding Protein-Like 3 (Nucleolar)-Like (GNL3L))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser GNL3L Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: GNL3 L antibody was raised using a synthetic peptide corresponding to a region with amino acids MMKLRHKNKKPGEGSKGHKKISWPYPQPAKQNGKKATSKVPSAPHFVHPN

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

GNL3L Blocking Peptide, catalog no. 33R-6234, is also available for use as a blocking control in assays to test for specificity of this GNL3L antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GNL0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu GNL3L

Target: GNL3L (Guanine Nucleotide Binding Protein-Like 3 (Nucleolar)-Like (GNL3L))

Andere Bezeichnung: GNL3L (GNL3L Produkte)

Synonyme: SI:zK13A21.8 antikoerper, flj10613 antikoerper, flj10613l antikoerper, si:dkey-13a21.8 antikoerper, zgc:110536 antikoerper, BC020354 antikoerper, guanine nucleotide binding protein-like 3 (nucleolar)-like antikoerper, guanine nucleotide binding protein-like 3 (nucleolar)-like S homeolog antikoerper, G protein nucleolar 3 like antikoerper, gnl3l antikoerper, gnl3l.S antikoerper, GNL3L antikoerper, Gnl3l antikoerper

Hintergrund: GNL3L is required for normal processing of ribosomal pre-rRNA and cell proliferation.

Molekulargewicht: 65 kDa (MW of target protein)