GABARAPL1 Antikörper
-
- Target Alle GABARAPL1 Antikörper anzeigen
- GABARAPL1 (GABA(A) Receptor-Associated Protein Like 1 (GABARAPL1))
-
Reaktivität
- Human, Ratte, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser GABARAPL1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- GABARAPL1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MKFQYKEDHPFEYRKKEGEKIRKKYPDRVPVIVEKAPKARVPDLDKRKYL
- Top Product
- Discover our top product GABARAPL1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
GABARAPL1 Blocking Peptide, catalog no. 33R-6137, is also available for use as a blocking control in assays to test for specificity of this GABARAPL1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GABARAPL1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- GABARAPL1 (GABA(A) Receptor-Associated Protein Like 1 (GABARAPL1))
- Andere Bezeichnung
- GABARAPL1 (GABARAPL1 Produkte)
- Synonyme
- gabarapl1 antikoerper, apg8l antikoerper, atg8 antikoerper, atg8l antikoerper, gec1 antikoerper, gabarapl1-a antikoerper, GABARAPL3 antikoerper, APG8-LIKE antikoerper, APG8L antikoerper, ATG8 antikoerper, ATG8B antikoerper, ATG8L antikoerper, GEC1 antikoerper, Gec1 antikoerper, 3110025G09Rik antikoerper, 9130422N19Rik antikoerper, AI196471 antikoerper, Apg8l antikoerper, Atg8l antikoerper, GECI antikoerper, GEC-1 antikoerper, GABA(A) receptor-associated protein like 1 antikoerper, GABA(A) receptor-associated protein like 1 S homeolog antikoerper, GABA type A receptor associated protein like 1 antikoerper, gamma-aminobutyric acid (GABA) A receptor-associated protein-like 1 antikoerper, gabarapl1 antikoerper, gabarapl1.S antikoerper, GABARAPL1 antikoerper, Gabarapl1 antikoerper
- Hintergrund
- GABARAPL1 increases cell-surface expression of kappa-type opioid receptor through facilitating anterograde intracellular trafficking of the receptor.
- Molekulargewicht
- 14 kDa (MW of target protein)
- Pathways
- Autophagie
-