COG4 Antikörper (Middle Region)
-
- Target Alle COG4 Antikörper anzeigen
- COG4 (Component of Oligomeric Golgi Complex 4 (COG4))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser COG4 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- COG4 antibody was raised against the middle region of COG4
- Aufreinigung
- Affinity purified
- Immunogen
- COG4 antibody was raised using the middle region of COG4 corresponding to a region with amino acids TSLVAVELEKVVLKSTFNRLGGLQFDKELRSLIAYLTTVTTWTIRDKFAR
- Top Product
- Discover our top product COG4 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
COG4 Blocking Peptide, catalog no. 33R-9290, is also available for use as a blocking control in assays to test for specificity of this COG4 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of COG4 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- COG4 (Component of Oligomeric Golgi Complex 4 (COG4))
- Andere Bezeichnung
- COG4 (COG4 Produkte)
- Synonyme
- COG4 antikoerper, DKFZp470I1314 antikoerper, CDG2J antikoerper, COD1 antikoerper, AW554810 antikoerper, D8Ertd515e antikoerper, zgc:136860 antikoerper, component of oligomeric golgi complex 4 antikoerper, COG4 antikoerper, cog4 antikoerper, Cog4 antikoerper
- Hintergrund
- Multiprotein complexes are key determinants of Golgi apparatus structure and its capacity for intracellular transport and glycoprotein modification. Several complexes have been identified, including the Golgi transport complex (GTC), the LDLC complex, which is involved in glycosylation reactions, and the SEC34 complex, which is involved in vesicular transport. These 3 complexes are identical and have been termed the conserved oligomeric Golgi (COG) complex, which includes COG4.
- Molekulargewicht
- 89 kDa (MW of target protein)
-