PPP2R5A Antikörper (N-Term)
-
- Target Alle PPP2R5A Antikörper anzeigen
- PPP2R5A (Protein Phosphatase 2, Regulatory Subunit B', alpha (PPP2R5A))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser PPP2R5A Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- PPP2 R2 antibody was raised against the N terminal of PPP2 2
- Aufreinigung
- Affinity purified
- Immunogen
- PPP2 R2 antibody was raised using the N terminal of PPP2 2 corresponding to a region with amino acids YVSTNRGVIVESAYSDIVKMISANIFRTLPPSDNPDFDPEEDEPTLEASW
- Top Product
- Discover our top product PPP2R5A Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
PPP2R5A Blocking Peptide, ABIN936266, is also available for use as a blocking control in assays to test for specificity of this PPP2R5A antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PPP0 0 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PPP2R5A (Protein Phosphatase 2, Regulatory Subunit B', alpha (PPP2R5A))
- Andere Bezeichnung
- PPP2R5A (PPP2R5A Produkte)
- Synonyme
- PR61alpha antikoerper, B56A antikoerper, PR61A antikoerper, si:dkey-18c8.1 antikoerper, protein phosphatase 2 regulatory subunit B'alpha antikoerper, protein phosphatase 2, regulatory subunit B', alpha antikoerper, protein phosphatase 2 regulatory subunit B', alpha antikoerper, protein phosphatase 2, regulatory subunit B', alpha isoform antikoerper, PPP2R5A antikoerper, Ppp2r5a antikoerper, ppp2r5a.S antikoerper, ppp2r5a antikoerper
- Hintergrund
- PPP2R5A belongs to the phosphatase 2A regulatory subunit B family. Protein phosphatase 2A is one of the four major Ser/Thr phosphatases, and it is implicated in the negative control of cell growth and division. It consists of a common heteromeric core enzyme, which is composed of a catalytic subunit and a constant regulatory subunit, that associates with a variety of regulatory subunits. The B regulatory subunit might modulate substrate selectivity and catalytic activity.
- Molekulargewicht
- 56 kDa (MW of target protein)
- Pathways
- PI3K-Akt Signalweg
-