KNG1 Antikörper (Middle Region)

Produktnummer ABIN631493

Produktdetails anti-KNG1 Antikörper

Target: KNG1 (Kininogen 1 (KNG1))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser KNG1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: KNG1 antibody was raised against the middle region of KNG1

Aufreinigung: Affinity purified

Immunogen: KNG1 antibody was raised using the middle region of KNG1 corresponding to a region with amino acids YPGKDFVQPPTKICVGCPRDIPTNSPELEETLTHTITKLNAENNATFYFK

Anwendungsinformationen

Applikationshinweise: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

KNG1 Blocking Peptide, catalog no. 33R-10197, is also available for use as a blocking control in assays to test for specificity of this KNG1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KNG1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu KNG1

Target: KNG1 (Kininogen 1 (KNG1))

Andere Bezeichnung: KNG1 (KNG1 Produkte)

Synonyme: BDK antikoerper, BK antikoerper, KNG antikoerper, Kng antikoerper, KNG2 antikoerper, fb64g01 antikoerper, wu:fb64g01 antikoerper, zgc:103569 antikoerper, kininogen antikoerper, bdk antikoerper, kng antikoerper, KNG1 antikoerper, IHRP antikoerper, KINKG antikoerper, KINKH antikoerper, Kng1 antikoerper, Kngk antikoerper, kininogen 1 antikoerper, kininogen 1 L homeolog antikoerper, inter-alpha-trypsin inhibitor heavy chain family member 4 antikoerper, kininogen 2-like 1 antikoerper, KNG1 antikoerper, Kng1 antikoerper, kng1 antikoerper, kng1.L antikoerper, ITIH4 antikoerper, Kng2l1 antikoerper

Hintergrund: Kininogens are inhibitors of thiol proteases. HMW-kininogen plays an important role in blood coagulation by helping to position optimally prekallikrein and factor XI next to factor XII and inhibits the thrombin- and plasmin-induced aggregation of thrombocytes. The active peptide bradykinin that is released from HMW-kininogen shows a variety of physiological effects such as influence in smooth muscle contraction, induction of hypotension, natriuresis and diuresis, etc.

Molekulargewicht: 72 kDa (MW of target protein)

Pathways: ACE Inhibitor Pathway, Glycosaminoglycan Metabolic Process