LRRC6 Antikörper (Middle Region)
-
- Target Alle LRRC6 Antikörper anzeigen
- LRRC6 (Leucine Rich Repeat Containing 6 (LRRC6))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser LRRC6 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- LRRC6 antibody was raised against the middle region of LRRC6
- Aufreinigung
- Affinity purified
- Immunogen
- LRRC6 antibody was raised using the middle region of LRRC6 corresponding to a region with amino acids MKTTSDRSREQTNTRSKHMEKLEVDPSKHSFPDVTNIVQEKKHTPRRRPE
- Top Product
- Discover our top product LRRC6 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
LRRC6 Blocking Peptide, catalog no. 33R-6170, is also available for use as a blocking control in assays to test for specificity of this LRRC6 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LRRC6 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- LRRC6 (Leucine Rich Repeat Containing 6 (LRRC6))
- Andere Bezeichnung
- LRRC6 (LRRC6 Produkte)
- Synonyme
- LRTP antikoerper, Lrtp antikoerper, Tslrp antikoerper, CILD19 antikoerper, TSLRP antikoerper, lrrc6l antikoerper, leucine rich repeat containing 6 (testis) antikoerper, leucine rich repeat containing 6 antikoerper, Lrrc6 antikoerper, LRRC6 antikoerper, lrrc6 antikoerper
- Hintergrund
- LRRC6 may be involved in spermatocytogenesis or prophase of meiosis.
- Molekulargewicht
- 51 kDa (MW of target protein)
- Pathways
- M Phase
-