Erythrocyte Ankyrin Antikörper (Middle Region)

Produktnummer ABIN631420

Produktdetails anti-Erythrocyte Ankyrin Antikörper

Target: Erythrocyte Ankyrin (ANK1) (Ankyrin 1, Erythrocytic (ANK1))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Erythrocyte Ankyrin Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: Ankyrin 1 antibody was raised against the middle region of ANK1

Aufreinigung: Affinity purified

Immunogen: Ankyrin 1 antibody was raised using the middle region of ANK1 corresponding to a region with amino acids PCAMPETVVIRSEEQEQASKEYDEDSLIPSSPATETSDNISPVASPVHTG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Ankyrin 1 Blocking Peptide, catalog no. 33R-6993, is also available for use as a blocking control in assays to test for specificity of this Ankyrin 1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ANK1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Erythrocyte Ankyrin

Target: Erythrocyte Ankyrin (ANK1) (Ankyrin 1, Erythrocytic (ANK1))

Andere Bezeichnung: Ankyrin 1 (ANK1 Produkte)

Synonyme: CHANK1 antikoerper, wu:fa09h06 antikoerper, zgc:101835 antikoerper, ank antikoerper, sph1 antikoerper, sph2 antikoerper, ANK1 antikoerper, ANK antikoerper, SPH1 antikoerper, SPH2 antikoerper, Ank-1 antikoerper, nb antikoerper, pale antikoerper, ankyrin 1 antikoerper, ankyrin 1, erythrocytic a antikoerper, ankyrin 1 L homeolog antikoerper, ankyrin 1, erythrocytic antikoerper, ankyrin 1, erythroid antikoerper, ANK1 antikoerper, ank1a antikoerper, ank1 antikoerper, ank1.L antikoerper, Ank1 antikoerper

Hintergrund: Ankyrins are a family of proteins that are believed to link the integral membrane proteins to the underlying spectrin-actin cytoskeleton and play key roles in activities such as cell motility, activation and proliferation.

Molekulargewicht: 189 kDa (MW of target protein)

Pathways: Synaptic Membrane