ATP6V1C1 Antikörper (N-Term)

Produktnummer ABIN631307

Produktdetails anti-ATP6V1C1 Antikörper

Target: ATP6V1C1 (ATPase, H+ Transporting, Lysosomal 42kDa, V1 Subunit C1 (ATP6V1C1))

Bindungsspezifität: N-Term

Reaktivität: Human, Ratte, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ATP6V1C1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: ATP6 V6 1 antibody was raised against the N terminal of ATP6 6 1

Aufreinigung: Affinity purified

Immunogen: ATP6 V6 1 antibody was raised using the N terminal of ATP6 6 1 corresponding to a region with amino acids MILLEVNNRIIEETLALKFENAAAGNKPEAVEVTFADFDGVLYHISNPNG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ATP6V1C1 Blocking Peptide, catalog no. 33R-6113, is also available for use as a blocking control in assays to test for specificity of this ATP6V1C1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ATP0 0 1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ATP6V1C1

Target: ATP6V1C1 (ATPase, H+ Transporting, Lysosomal 42kDa, V1 Subunit C1 (ATP6V1C1))

Andere Bezeichnung: ATP6V1C1 (ATP6V1C1 Produkte)

Synonyme: ATP6C antikoerper, ATP6D antikoerper, VATC antikoerper, Vma5 antikoerper, 1700025B18Rik antikoerper, U13839 antikoerper, vatC antikoerper, ATPase antikoerper, atp6v1c1 antikoerper, si:zc215i13.2 antikoerper, wu:fd12h05 antikoerper, atp6v1c1l antikoerper, zgc:92684 antikoerper, ATPase H+ transporting V1 subunit C1 antikoerper, ATPase, H+ transporting, lysosomal V1 subunit C1 antikoerper, ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C1 antikoerper, ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C1 L homeolog antikoerper, ATPase, H+ transporting, lysosomal, V1 subunit C1a antikoerper, ATPase, H+ transporting, lysosomal, V1 subunit C1b antikoerper, ATP6V1C1 antikoerper, Atp6v1c1 antikoerper, atp6v1c1 antikoerper, atp6v1c1.L antikoerper, atp6v1c1a antikoerper, atp6v1c1b antikoerper

Hintergrund: ATP6V1C1 is a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of intracellular compartments of eukaryotic cells. V-ATPase dependent acidification is necessary for such intracellular processes as protein sorting, zymogen activation, receptor-mediated endocytosis, and synaptic vesicle proton gradient generation.

Molekulargewicht: 42 kDa (MW of target protein)

Pathways: Transition Metal Ion Homeostasis, Proton Transport