PRKAR1B Antikörper (Middle Region)

Produktnummer ABIN631278

Produktdetails anti-PRKAR1B Antikörper

Target: PRKAR1B (Protein Kinase, CAMP-Dependent, Regulatory, Type I, beta (PRKAR1B))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PRKAR1B Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: PRKAR1 B antibody was raised against the middle region of PRKAR1

Aufreinigung: Affinity purified

Immunogen: PRKAR1 B antibody was raised using the middle region of PRKAR1 corresponding to a region with amino acids LNRPRAATVVARGPLKCVKLDRPRFERVLGPCSEILKRNIQRYNSFISLT

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PRKAR1B Blocking Peptide, catalog no. 33R-5240, is also available for use as a blocking control in assays to test for specificity of this PRKAR1B antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRKAR0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PRKAR1B

Target: PRKAR1B (Protein Kinase, CAMP-Dependent, Regulatory, Type I, beta (PRKAR1B))

Andere Bezeichnung: PRKAR1B (PRKAR1B Produkte)

Synonyme: PRKAR1B antikoerper, AI385716 antikoerper, RIbeta antikoerper, RGD1563094 antikoerper, PRKAR1 antikoerper, zgc:153624 antikoerper, prkar1 antikoerper, protein kinase cAMP-dependent type I regulatory subunit beta antikoerper, protein kinase, cAMP dependent regulatory, type I beta antikoerper, protein kinase cAMP-dependent type 1 regulatory subunit beta antikoerper, protein kinase, cAMP-dependent, regulatory, type I, beta antikoerper, protein kinase, cAMP-dependent, regulatory subunit type I beta S homeolog antikoerper, PRKAR1B antikoerper, prkar1b antikoerper, Prkar1b antikoerper, prkar1b.S antikoerper

Hintergrund: Cyclic AMP-dependent protein kinase A (PKA) is an essential enzyme in the signaling pathway of the second messenger cAMP. Through phosphorylation of target proteins, PKA controls many biochemical events in the cell including regulation of metabolism.

Molekulargewicht: 43 kDa (MW of target protein)

Pathways: Hedgehog Signalweg, EGFR Signaling Pathway, Neurotrophin Signalübertragung, Myometrial Relaxation and Contraction, G-protein mediated Events, Interaction of EGFR with phospholipase C-gamma