APPL1 Antikörper (Middle Region)
-
- Target Alle APPL1 Antikörper anzeigen
- APPL1 (Adaptor Protein, phosphotyrosine Interaction, PH Domain and Leucine Zipper Containing 1 (APPL1))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser APPL1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- APPL1 antibody was raised against the middle region of APPL1
- Aufreinigung
- Affinity purified
- Immunogen
- APPL1 antibody was raised using the middle region of APPL1 corresponding to a region with amino acids GQAKAFGQGGRRTNPFGESGGSTKSETEDSILHQLFIVRFLGSMEVKSDD
- Top Product
- Discover our top product APPL1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
APPL1 Blocking Peptide, catalog no. 33R-3487, is also available for use as a blocking control in assays to test for specificity of this APPL1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of APPL1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- APPL1 (Adaptor Protein, phosphotyrosine Interaction, PH Domain and Leucine Zipper Containing 1 (APPL1))
- Andere Bezeichnung
- APPL1 (APPL1 Produkte)
- Synonyme
- APPL antikoerper, DIP13alpha antikoerper, 2900057D21Rik antikoerper, 7330406P05Rik antikoerper, AI585782 antikoerper, AW209077 antikoerper, BB022931 antikoerper, C88264 antikoerper, DIP13 antikoerper, RGD1309388 antikoerper, adaptor protein, phosphotyrosine interacting with PH domain and leucine zipper 1 antikoerper, adaptor protein, phosphotyrosine interaction, PH domain and leucine zipper containing 1 antikoerper, APPL1 antikoerper, Appl1 antikoerper
- Hintergrund
- The protein encoded by this gene has been shown to be involved in the regulation of cell proliferation, and in the crosstalk between the adiponectin signalling and insulin signalling pathways. The encoded protein binds many other proteins, including RAB5A.
- Molekulargewicht
- 80 kDa (MW of target protein)
-