Ketohexokinase Antikörper

Produktnummer ABIN631256

Produktdetails anti-Ketohexokinase Antikörper

Target: Ketohexokinase (KHK)

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Ketohexokinase Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: KHK antibody was raised using a synthetic peptide corresponding to a region with amino acids FLVADFRRRGVDVSQVAWQSKGDTPSSCCIINNSNGNRTIVLHDTSLPDV

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

KHK Blocking Peptide, catalog no. 33R-2992, is also available for use as a blocking control in assays to test for specificity of this KHK antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KHK antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Ketohexokinase

Target: Ketohexokinase (KHK)

Andere Bezeichnung: KHK (KHK Produkte)

Synonyme: wu:fj68h03 antikoerper, zgc:92219 antikoerper, zgc:92626 antikoerper, KHK antikoerper, khk antikoerper, KETHPRO antikoerper, ketohexokinase antikoerper, Ketohexokinase antikoerper, KHK antikoerper, khk antikoerper, Hhal_0921 antikoerper, AaeL_AAEL006316 antikoerper, Nwat_0240 antikoerper, Khk antikoerper

Hintergrund: KHK is a ketohexokinase that catalyzes conversion of fructose to fructose-1-phosphate. The product of this gene is the first enzyme with a specialized pathway that catabolizes dietary fructose.

Molekulargewicht: 32 kDa (MW of target protein)