Aurora Kinase C Antikörper (Middle Region)

Produktnummer ABIN631252

Produktdetails anti-Aurora Kinase C Antikörper

Target: Aurora Kinase C (AURKC)

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Aurora Kinase C Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: AURKC antibody was raised against the middle region of AURKC

Aufreinigung: Affinity purified

Immunogen: AURKC antibody was raised using the middle region of AURKC corresponding to a region with amino acids TYDEKVDLWCIGVLCYELLVGYPPFESASHSETYRRILKVDVRFPLSMPL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

AURKC Blocking Peptide, catalog no. 33R-9386, is also available for use as a blocking control in assays to test for specificity of this AURKC antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AURKC antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Aurora Kinase C

Target: Aurora Kinase C (AURKC)

Andere Bezeichnung: AURKC (AURKC Produkte)

Synonyme: AURKC antikoerper, AIE2 antikoerper, AIK3 antikoerper, ARK3 antikoerper, AurC antikoerper, SPGF5 antikoerper, STK13 antikoerper, aurora-C antikoerper, AIE1 antikoerper, ARK-3 antikoerper, IAK3 antikoerper, Stk13 antikoerper, aurora kinase C antikoerper, AURKC antikoerper, Aurkc antikoerper

Hintergrund: AURKC may play a part in organizing microtubules in relation to the function of the centrosome/spindle pole during mitosis.

Molekulargewicht: 34 kDa (MW of target protein)

Pathways: Zellzyklus, Maintenance of Protein Location