PTP4A3 Antikörper (Middle Region)

Produktnummer ABIN631230

Produktdetails anti-PTP4A3 Antikörper

Target: PTP4A3 (Protein Tyrosine Phosphatase Type IVA, Member 3 (PTP4A3))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PTP4A3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: PTP4 A3 antibody was raised against the middle region of PTP4 3

Aufreinigung: Affinity purified

Immunogen: PTP4 A3 antibody was raised using the middle region of PTP4 3 corresponding to a region with amino acids LGRAPVLVALALIESGMKYEDAIQFIRQKRRGAINSKQLTYLEKYRPKQR

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PTP4A3 Blocking Peptide, catalog no. 33R-4993, is also available for use as a blocking control in assays to test for specificity of this PTP4A3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PTP0 3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PTP4A3

Target: PTP4A3 (Protein Tyrosine Phosphatase Type IVA, Member 3 (PTP4A3))

Andere Bezeichnung: PTP4A3 (PTP4A3 Produkte)

Synonyme: PRL-3 antikoerper, PRL-R antikoerper, PRL3 antikoerper, wu:fc54b05 antikoerper, wu:fv52d11 antikoerper, zgc:77109 antikoerper, prl-3 antikoerper, prl3 antikoerper, ptpcaax3 antikoerper, PTP4A3 antikoerper, AV088979 antikoerper, Prl-3 antikoerper, pPtp4a3 antikoerper, protein tyrosine phosphatase type IVA, member 3 antikoerper, protein tyrosine phosphatase type IVA, member 3 L homeolog antikoerper, protein tyrosine phosphatase 4a3 antikoerper, PTP4A3 antikoerper, ptp4a3 antikoerper, ptp4a3.L antikoerper, Ptp4a3 antikoerper

Hintergrund: PTP4A3 belongs to a small class of prenylated protein tyrosine phosphatases (PTPs). PTPs are cell signaling molecules that play regulatory roles in a variety of cellular processes. This class of PTPs contains a PTP domain and a characteristic C-terminal prenylation motif. Studies of this class of PTPs in mice demonstrated that they were prenylated proteins in vivo, which suggested their association with cell plasma membrane. Overexpression of this gene in mammalian cells was reported to inhibit angiotensin-II induced cell calcium mobilization and promote cell growth.

Molekulargewicht: 19 kDa (MW of target protein)