NEDD4-2 Antikörper (Middle Region)
-
- Target Alle NEDD4-2 (NEDD4L) Antikörper anzeigen
- NEDD4-2 (NEDD4L) (E3 ubiquitin-protein ligase NEDD4-like (NEDD4L))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser NEDD4-2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- NEDD4 L antibody was raised against the middle region of NEDD4
- Aufreinigung
- Affinity purified
- Immunogen
- NEDD4 L antibody was raised using the middle region of NEDD4 corresponding to a region with amino acids TVTLSAPLEGAKDSPVRRAVKDTLSNPQSPQPSPYNSPKPQHKVTQSFLP
- Top Product
- Discover our top product NEDD4L Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
NEDD4L Blocking Peptide, catalog no. 33R-9373, is also available for use as a blocking control in assays to test for specificity of this NEDD4L antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NEDD0 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- NEDD4-2 (NEDD4L) (E3 ubiquitin-protein ligase NEDD4-like (NEDD4L))
- Andere Bezeichnung
- NEDD4L (NEDD4L Produkte)
- Synonyme
- NEDD4-2 antikoerper, NEDD4.2 antikoerper, RSP5 antikoerper, hNEDD4-2 antikoerper, nedd4 antikoerper, nedd4-2 antikoerper, NEDD4 antikoerper, Nedd4-2 antikoerper, 1300012C07Rik antikoerper, Nedd4b antikoerper, neural precursor cell expressed, developmentally down-regulated 4-like, E3 ubiquitin protein ligase antikoerper, NEDD4L antikoerper, neural precursor cell expressed, developmentally down-regulated 4-like, E3 ubiquitin protein ligase S homeolog antikoerper, neural precursor cell expressed, developmentally down-regulated gene 4-like antikoerper, NEDD4L antikoerper, LOC776799 antikoerper, nedd4l.S antikoerper, Nedd4l antikoerper
- Hintergrund
- NEDD4L is an E3 ubiquitin-protein ligase which accepts ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfers the ubiquitin to targeted substrates. NEDD4L inhibits TGF-beta signaling by triggering SMAD2 and TGFR1 ubiquitination and proteasome-dependent degradation.
- Molekulargewicht
- 110 kDa (MW of target protein)
- Pathways
- Negative Regulation of Transporter Activity
-