NEDD4-2 Antikörper (Middle Region)

Produktnummer ABIN631206

Produktdetails anti-NEDD4-2 Antikörper

Target: NEDD4-2 (NEDD4L) (E3 ubiquitin-protein ligase NEDD4-like (NEDD4L))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser NEDD4-2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: NEDD4 L antibody was raised against the middle region of NEDD4

Aufreinigung: Affinity purified

Immunogen: NEDD4 L antibody was raised using the middle region of NEDD4 corresponding to a region with amino acids TVTLSAPLEGAKDSPVRRAVKDTLSNPQSPQPSPYNSPKPQHKVTQSFLP

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

NEDD4L Blocking Peptide, catalog no. 33R-9373, is also available for use as a blocking control in assays to test for specificity of this NEDD4L antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NEDD0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu NEDD4-2

Target: NEDD4-2 (NEDD4L) (E3 ubiquitin-protein ligase NEDD4-like (NEDD4L))

Andere Bezeichnung: NEDD4L (NEDD4L Produkte)

Synonyme: NEDD4-2 antikoerper, NEDD4.2 antikoerper, RSP5 antikoerper, hNEDD4-2 antikoerper, nedd4 antikoerper, nedd4-2 antikoerper, NEDD4 antikoerper, Nedd4-2 antikoerper, 1300012C07Rik antikoerper, Nedd4b antikoerper, neural precursor cell expressed, developmentally down-regulated 4-like, E3 ubiquitin protein ligase antikoerper, NEDD4L antikoerper, neural precursor cell expressed, developmentally down-regulated 4-like, E3 ubiquitin protein ligase S homeolog antikoerper, neural precursor cell expressed, developmentally down-regulated gene 4-like antikoerper, NEDD4L antikoerper, LOC776799 antikoerper, nedd4l.S antikoerper, Nedd4l antikoerper

Hintergrund: NEDD4L is an E3 ubiquitin-protein ligase which accepts ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfers the ubiquitin to targeted substrates. NEDD4L inhibits TGF-beta signaling by triggering SMAD2 and TGFR1 ubiquitination and proteasome-dependent degradation.

Molekulargewicht: 110 kDa (MW of target protein)

Pathways: Negative Regulation of Transporter Activity