SULT2B1 Antikörper (N-Term)
-
- Target Alle SULT2B1 Antikörper anzeigen
- SULT2B1 (Sulfotransferase Family, Cytosolic, 2B, Member 1 (SULT2B1))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser SULT2B1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- SULT2 B1 antibody was raised against the N terminal of SULT2 1
- Aufreinigung
- Affinity purified
- Immunogen
- SULT2 B1 antibody was raised using the N terminal of SULT2 1 corresponding to a region with amino acids MASPPPFHSQKLPGEYFRYKGVPFPVGLYSLESISLAENTQDVRDDDIFI
- Top Product
- Discover our top product SULT2B1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
SULT2B1 Blocking Peptide, catalog no. 33R-5757, is also available for use as a blocking control in assays to test for specificity of this SULT2B1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SULT0 1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SULT2B1 (Sulfotransferase Family, Cytosolic, 2B, Member 1 (SULT2B1))
- Andere Bezeichnung
- SULT2B1 (SULT2B1 Produkte)
- Synonyme
- HSST2 antikoerper, AI326997 antikoerper, BB173635 antikoerper, ST2B1 antikoerper, SULT2B antikoerper, SULT2B1 antikoerper, MGC79784 antikoerper, sulfotransferase family 2B member 1 antikoerper, sulfotransferase family, cytosolic, 2B, member 1 antikoerper, sulfotransferase family 2B member 1 L homeolog antikoerper, SULT2B1 antikoerper, Sult2b1 antikoerper, sult2b1 antikoerper, sult2b1.L antikoerper
- Hintergrund
- Sulfotransferase enzymes catalyze the sulfate conjugation of many hormones, neurotransmitters, drugs, and xenobiotic compounds. These cytosolic enzymes are different in their tissue distributions and substrate specificities.
- Molekulargewicht
- 39 kDa (MW of target protein)
- Pathways
- Steroid Hormone Biosynthesis
-