DNAJB6 Antikörper

Produktnummer ABIN631148

Produktdetails anti-DNAJB6 Antikörper

Target: DNAJB6 (DnaJ (Hsp40) Homolog, Subfamily B, Member 6 (DNAJB6))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser DNAJB6 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: DNAJB6 antibody was raised using a synthetic peptide corresponding to a region with amino acids PENKEEAERKFKQVAEAYEVLSDAKKRDIYDKYGKEGLNGGGGGGSHFDS

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

DNAJB6 Blocking Peptide, catalog no. 33R-7052, is also available for use as a blocking control in assays to test for specificity of this DNAJB6 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DNAJB6 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu DNAJB6

Target: DNAJB6 (DnaJ (Hsp40) Homolog, Subfamily B, Member 6 (DNAJB6))

Andere Bezeichnung: DNAJB6 (DNAJB6 Produkte)

Synonyme: DJ4 antikoerper, DnaJ antikoerper, HHDJ1 antikoerper, HSJ-2 antikoerper, HSJ2 antikoerper, LGMD1E antikoerper, MRJ antikoerper, MSJ-1 antikoerper, Mrj antikoerper, mDj4 antikoerper, dnajb6 antikoerper, zgc:56709 antikoerper, hsj2 antikoerper, DnaJ heat shock protein family (Hsp40) member B6 antikoerper, DnaJ (Hsp40) homolog, subfamily B, member 6b antikoerper, DnaJ heat shock protein family (Hsp40) member B6 S homeolog antikoerper, DnaJ heat shock protein family (Hsp40) member B6 L homeolog antikoerper, DNAJB6 antikoerper, Dnajb6 antikoerper, dnajb6b antikoerper, dnajb6.S antikoerper, dnajb6.L antikoerper

Hintergrund: DNAJB6 is a member of the DNAJ protein family. DNAJ family members are characterized by a highly conserved amino acid stretch called the 'J-domain' and function as one of the two major classes of molecular chaperones involved in a wide range of cellular events, such as protein folding and oligomeric protein complex assembly. This family member may also play a role in polyglutamine aggregation in specific neurons.

Molekulargewicht: 36 kDa (MW of target protein)