Diazepam Binding Inhibitor Antikörper

Produktnummer ABIN631130

Produktdetails anti-Diazepam Binding Inhibitor Antikörper

Target: Diazepam Binding Inhibitor (DBI)

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Diazepam Binding Inhibitor Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: DBI antibody was raised using a synthetic peptide corresponding to a region with amino acids MSQAEFEKAAEEVRHLKTKPSDEEMLFIYGHYKQATVGDINTERPGMLDF

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

DBI Blocking Peptide, catalog no. 33R-6477, is also available for use as a blocking control in assays to test for specificity of this DBI antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DBI antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Diazepam Binding Inhibitor

Target: Diazepam Binding Inhibitor (DBI)

Andere Bezeichnung: DBI (DBI Produkte)

Synonyme: ACBD1 antikoerper, ACBP antikoerper, CCK-RP antikoerper, EP antikoerper, dbib antikoerper, DBI antikoerper, wu:fb63e10 antikoerper, zgc:56108 antikoerper, zgc:77734 antikoerper, Acbp antikoerper, endozepine antikoerper, Acoabp3 antikoerper, Ep antikoerper, Odn antikoerper, RNACOABP3 antikoerper, Ttn antikoerper, acbd1 antikoerper, acbp antikoerper, cck-rp antikoerper, dbi antikoerper, dbi-a antikoerper, dbi-b antikoerper, dbia antikoerper, diazepam binding inhibitor, acyl-CoA binding protein antikoerper, diazepam binding inhibitor (GABA receptor modulator, acyl-CoA binding protein) S homeolog antikoerper, diazepam-binding inhibitor antikoerper, diazepam binding inhibitor (GABA receptor modulator, acyl-CoA binding protein) antikoerper, acyl-CoA-binding protein antikoerper, diazepam binding inhibitor antikoerper, diazepam binding inhibitor (GABA receptor modulator, acyl-CoA binding protein) L homeolog antikoerper, DBI antikoerper, dbi.S antikoerper, dbi antikoerper, LOC706367 antikoerper, Dbi antikoerper, dbi.L antikoerper

Hintergrund: DBI is diazepam binding inhibitor. The protein that is regulated by hormones and is involved in lipid metabolism and the displacement of beta-carbolines and benzodiazepines, which modulate signal transduction at type A gamma-aminobutyric acid receptors located in brain synapses. DBI is conserved from yeast to mammals, with the most highly conserved domain consisting of seven contiguous residues that constitute the hydrophobic binding site for medium- and long-chain acyl-Coenzyme A esters. Diazepam binding inhibitor is also known to mediate the feedback regulation of pancreatic secretion and the postprandial release of cholecystokinin, in addition to its role as a mediator in corticotropin-dependent adrenal steroidogenesis.

Molekulargewicht: 10 kDa (MW of target protein)