HAX1 Antikörper (Middle Region)

Produktnummer ABIN631119

Der Kaninchen Polyklonal anti-HAX1 Antikörper (ABIN631119) detektiert spezifisch HAX1 in WB. Dieser Antikörper reagiert spezifisch mit Proben aus Human und Maus.

Kurzübersicht für HAX1 Antikörper (Middle Region) (ABIN631119)

Target: HAX1 (HCLS1 Associated Protein X-1 (HAX1))

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser HAX1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-HAX1 Antikörper

Bindungsspezifität: Middle Region

Spezifität: HAX1 antibody was raised against the middle region of HAX1

Aufreinigung: Affinity purified

Immunogen: HAX1 antibody was raised using the middle region of HAX1 corresponding to a region with amino acids LPGPESETPGERLREGQTLRDSMLKYPDSHQPRIFGGVLESDARSESPQP

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

HAX1 Blocking Peptide, (ABIN5613936), is also available for use as a blocking control in assays to test for specificity of this HAX1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HAX1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu HAX1

Target: HAX1 (HCLS1 Associated Protein X-1 (HAX1))

Andere Bezeichnung: HAX1

Hintergrund: HAX1 is known to associate with hematopoietic cell-specific Lyn substrate 1, a substrate of Src family tyrosine kinases. It also interacts with the product of the polycystic kidney disease 2 gene, mutations in which are associated with autosomal-dominant polycystic kidney disease, and with the F-actin-binding protein, cortactin. It was earlier thought that this gene product is mainly localized in the mitochondria, however, recent studies indicate it to be localized in the cell body. Mutations in this gene result in autosomal recessive severe congenital neutropenia, also known as Kostmann disease.

Molekulargewicht: 31 kDa (MW of target protein)

Pathways: Regulation of Actin Filament Polymerization