HAX1 Antikörper (Middle Region)
-
- Target Alle HAX1 Antikörper anzeigen
- HAX1 (HCLS1 Associated Protein X-1 (HAX1))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser HAX1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- HAX1 antibody was raised against the middle region of HAX1
- Aufreinigung
- Affinity purified
- Immunogen
- HAX1 antibody was raised using the middle region of HAX1 corresponding to a region with amino acids LPGPESETPGERLREGQTLRDSMLKYPDSHQPRIFGGVLESDARSESPQP
- Top Product
- Discover our top product HAX1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
HAX1 Blocking Peptide, catalog no. 33R-5266, is also available for use as a blocking control in assays to test for specificity of this HAX1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HAX1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- HAX1 (HCLS1 Associated Protein X-1 (HAX1))
- Andere Bezeichnung
- HAX1 (HAX1 Produkte)
- Synonyme
- HAX1 antikoerper, hax1 antikoerper, HCLSBP1 antikoerper, HS1BP1 antikoerper, SCN3 antikoerper, HAX-1 antikoerper, Hs1bp1 antikoerper, HSP1BP-1 antikoerper, SIG-111 antikoerper, Silg111 antikoerper, mHAX-1s antikoerper, HCLS1 associated protein X-1 antikoerper, HCLS1 associated X-1 antikoerper, HAX1 antikoerper, hax1 antikoerper, Hax1 antikoerper
- Hintergrund
- HAX1 is known to associate with hematopoietic cell-specific Lyn substrate 1, a substrate of Src family tyrosine kinases. It also interacts with the product of the polycystic kidney disease 2 gene, mutations in which are associated with autosomal-dominant polycystic kidney disease, and with the F-actin-binding protein, cortactin. It was earlier thought that this gene product is mainly localized in the mitochondria, however, recent studies indicate it to be localized in the cell body. Mutations in this gene result in autosomal recessive severe congenital neutropenia, also known as Kostmann disease.
- Molekulargewicht
- 31 kDa (MW of target protein)
- Pathways
- Regulation of Actin Filament Polymerization
-