HAX1 Antikörper (Middle Region)

Produktnummer ABIN631118

Produktdetails anti-HAX1 Antikörper

Target: HAX1 (HCLS1 Associated Protein X-1 (HAX1))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser HAX1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: HAX1 antibody was raised against the middle region of HAX1

Aufreinigung: Affinity purified

Immunogen: HAX1 antibody was raised using the middle region of HAX1 corresponding to a region with amino acids QPAPDWGSQRPFHRFDDVWPMDPHPRTREDNDLDSQVSQEGLGPVLQPQP

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

HAX1 Blocking Peptide, catalog no. 33R-7672, is also available for use as a blocking control in assays to test for specificity of this HAX1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HAX1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu HAX1

Target: HAX1 (HCLS1 Associated Protein X-1 (HAX1))

Andere Bezeichnung: HAX1 (HAX1 Produkte)

Synonyme: HAX1 antikoerper, hax1 antikoerper, HCLSBP1 antikoerper, HS1BP1 antikoerper, SCN3 antikoerper, HAX-1 antikoerper, Hs1bp1 antikoerper, HSP1BP-1 antikoerper, SIG-111 antikoerper, Silg111 antikoerper, mHAX-1s antikoerper, HCLS1 associated protein X-1 antikoerper, HCLS1 associated X-1 antikoerper, HAX1 antikoerper, hax1 antikoerper, Hax1 antikoerper

Hintergrund: HAX1 is known to associate with hematopoietic cell-specific Lyn substrate 1, a substrate of Src family tyrosine kinases. It also interacts with the product of the polycystic kidney disease 2 gene, mutations in which are associated with autosomal-dominant polycystic kidney disease, and with the F-actin-binding protein, cortactin. It was earlier thought that this gene product is mainly localized in the mitochondria, however, recent studies indicate it to be localized in the cell body.

Molekulargewicht: 25 kDa (MW of target protein)

Pathways: Regulation of Actin Filament Polymerization