INPP5B Antikörper (Middle Region)

Produktnummer ABIN631045

Produktdetails anti-INPP5B Antikörper

Target: INPP5B (Inositol Polyphosphate-5-Phosphatase, 75kDa (INPP5B))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser INPP5B Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: INPP5 B antibody was raised against the middle region of INPP5

Aufreinigung: Affinity purified

Immunogen: INPP5 B antibody was raised using the middle region of INPP5 corresponding to a region with amino acids IHNGQVPCHFEFINKPDEESYCKQWLNANPSRGFLLPDSDVEIDLELFVN

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

INPP5B Blocking Peptide, catalog no. 33R-3984, is also available for use as a blocking control in assays to test for specificity of this INPP5B antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of INPP0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu INPP5B

Target: INPP5B (Inositol Polyphosphate-5-Phosphatase, 75kDa (INPP5B))

Andere Bezeichnung: INPP5B (INPP5B Produkte)

Synonyme: 75kDa antikoerper, AW260155 antikoerper, INPP5P antikoerper, 5PTase antikoerper, inositol polyphosphate-5-phosphatase B antikoerper, type II inositol 1,4,5-trisphosphate 5-phosphatase-like antikoerper, inositol polyphosphate-5-phosphatase B L homeolog antikoerper, inositol polyphosphate 5-phosphatase OCRL-1 antikoerper, INPP5B antikoerper, LOC100224437 antikoerper, inpp5b.L antikoerper, LOC100159919 antikoerper, Inpp5b antikoerper

Hintergrund: Cellular calcium signaling is controlled by the production of inositol phosphates (IPs) by phospholipase C in response to extracellular signals. The IP signaling molecules are inactivated by a family of inositol polyphosphate-5-phosphatases (5-phosphatases). INPP5B is the type II 5-phosphatase. The protein is localized to the cytosol and mitochondria, and associates with membranes through an isoprenyl modification near the C-terminus.

Molekulargewicht: 77 kDa (MW of target protein)