INPP5B Antikörper (Middle Region)

Produktnummer ABIN631045

Dieser Kaninchen Polyklonal Antikörper detektiert spezifisch INPP5B in WB. Es zeigt Reaktivität gegenüber Proben von Human und Maus.

Kurzübersicht für INPP5B Antikörper (Middle Region) (ABIN631045)

Target: INPP5B (Inositol Polyphosphate-5-Phosphatase, 75kDa (INPP5B))

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser INPP5B Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-INPP5B Antikörper

Bindungsspezifität: Middle Region

Spezifität: INPP5 B antibody was raised against the middle region of INPP5

Aufreinigung: Affinity purified

Immunogen: INPP5 B antibody was raised using the middle region of INPP5 corresponding to a region with amino acids IHNGQVPCHFEFINKPDEESYCKQWLNANPSRGFLLPDSDVEIDLELFVN

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

INPP5B Blocking Peptide, (ABIN939370), is also available for use as a blocking control in assays to test for specificity of this INPP5B antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of INPP0 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu INPP5B

Target: INPP5B (Inositol Polyphosphate-5-Phosphatase, 75kDa (INPP5B))

Andere Bezeichnung: INPP5B

Hintergrund: Cellular calcium signaling is controlled by the production of inositol phosphates (IPs) by phospholipase C in response to extracellular signals. The IP signaling molecules are inactivated by a family of inositol polyphosphate-5-phosphatases (5-phosphatases). INPP5B is the type II 5-phosphatase. The protein is localized to the cytosol and mitochondria, and associates with membranes through an isoprenyl modification near the C-terminus.

Molekulargewicht: 77 kDa (MW of target protein)