Kallikrein 6 Antikörper (N-Term)

Produktnummer ABIN631039

Produktdetails anti-Kallikrein 6 Antikörper

Target: Kallikrein 6 (KLK6)

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Kallikrein 6 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: KLK6 antibody was raised against the N terminal of KLK6

Aufreinigung: Affinity purified

Immunogen: KLK6 antibody was raised using the N terminal of KLK6 corresponding to a region with amino acids KHNLRQRESSQEQSSVVRAVIHPDYDAASHDQDIMLLRLARPAKLSELIQ

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

KLK6 Blocking Peptide, catalog no. 33R-4416, is also available for use as a blocking control in assays to test for specificity of this KLK6 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KLK6 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Kallikrein 6

Target: Kallikrein 6 (KLK6)

Andere Bezeichnung: KLK6 (KLK6 Produkte)

Synonyme: Bssp antikoerper, Klk7 antikoerper, PRSS18 antikoerper, PRSS9 antikoerper, SP59 antikoerper, hK6 antikoerper, Prss9 antikoerper, AI849898 antikoerper, BSP antikoerper, Klk29 antikoerper, MSP antikoerper, Prss18 antikoerper, neurosin antikoerper, kallikrein related peptidase 6 antikoerper, kallikrein related-peptidase 6 antikoerper, kallikrein-6 antikoerper, KLK6 antikoerper, Klk6 antikoerper, LOC100716801 antikoerper

Hintergrund: Kallikreins are a subgroup of serine proteases having diverse physiological functions. Growing evidence suggests that many kallikreins are implicated in carcinogenesis and some have potential as novel cancer and other disease biomarkers. The gene that encodes KLK6 protein is one of the fifteen kallikrein subfamily members located in a cluster on chromosome 19. KLK6 is regulated by steroid hormones. In tissue culture, the enzyme has been found to generate amyloidogenic fragments from the amyloid precursor protein, suggesting a potential for involvement in Alzheimer's disease.

Molekulargewicht: 25 kDa (MW of target protein)

Pathways: Komplementsystem, Regulation of G-Protein Coupled Receptor Protein Signaling