NAT15 Antikörper
-
- Target Alle NAT15 Antikörper anzeigen
- NAT15 (N-Acetyltransferase 15 (NAT15))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser NAT15 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- NAT15 antibody was raised using a synthetic peptide corresponding to a region with amino acids DYIQHLGSALASLSPCSIPHRVYRQAHSLLCSFLPWSGISSKSGIEYSRT
- Top Product
- Discover our top product NAT15 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
NAT15 Blocking Peptide, catalog no. 33R-2239, is also available for use as a blocking control in assays to test for specificity of this NAT15 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NAT15 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- NAT15 (N-Acetyltransferase 15 (NAT15))
- Andere Bezeichnung
- NAT15 (NAT15 Produkte)
- Synonyme
- nat15 antikoerper, im:7141641 antikoerper, naa60 antikoerper, zgc:163109 antikoerper, HAT4 antikoerper, NAT15 antikoerper, 1200013P24Rik antikoerper, AI315146 antikoerper, Nat15 antikoerper, RGD1308915 antikoerper, N(alpha)-acetyltransferase 60, NatF catalytic subunit antikoerper, N-acetyltransferase 15 (GCN5-related, putative) antikoerper, naa60 antikoerper, nat15 antikoerper, NAA60 antikoerper, Naa60 antikoerper
- Hintergrund
- NAT15 most likely functions as an N-acetyltransferase.
- Molekulargewicht
- 27 kDa (MW of target protein)
-