CSTB Antikörper

Produktnummer ABIN630947

Produktdetails anti-CSTB Antikörper

Target: CSTB (Cystatin B (Stefin B) (CSTB))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CSTB Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Aufreinigung: Affinity purified

Immunogen: Cystatin B antibody was raised using a synthetic peptide corresponding to a region with amino acids AGTNYFIKVHVGDEDFVHLRVFQSLPHENKPLTLSNYQTNKAKHDELTYF

Anwendungsinformationen

Applikationshinweise: WB: 0.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Cystatin B Blocking Peptide, catalog no. 33R-1232, is also available for use as a blocking control in assays to test for specificity of this Cystatin B antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CSTB antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CSTB

Target: CSTB (Cystatin B (Stefin B) (CSTB))

Andere Bezeichnung: Cystatin B (CSTB Produkte)

Synonyme: CST6 antikoerper, EPM1 antikoerper, EPM1A antikoerper, PME antikoerper, STFB antikoerper, ULD antikoerper, CSTB antikoerper, Cyb antikoerper, Epm1 antikoerper, Stfb antikoerper, MGC189005 antikoerper, pme antikoerper, cst6 antikoerper, epm1 antikoerper, stfb antikoerper, AA960480 antikoerper, ARABIDOPSIS THALIANA PHYTOCYSTATIN 6 antikoerper, ATCYS6 antikoerper, ATCYSB antikoerper, cystatin B antikoerper, LOC100008600 antikoerper, LOC100136235 antikoerper, CPI1 antikoerper, cystatin B antikoerper, cystatin B (stefin B) antikoerper, cystatin 14a, tandem duplicate 2 antikoerper, cystatin-B antikoerper, CSTB antikoerper, Cstb antikoerper, cstb antikoerper, cst14a.2 antikoerper, CYSB antikoerper, cpi1 antikoerper, LOC101123265 antikoerper

Hintergrund: CSTB is a stefin that functions as an intracellular thiol protease inhibitor. The protein is able to form a dimer stabilized by noncovalent forces, inhibiting papain and cathepsins l, h and b. The protein is thought to play a role in protecting against the proteases leaking from lysosomes. Evidence indicates that mutations in CSTB gene are responsible for the primary defects in patients with progressive myoclonic epilepsy a stefin that functions as an intracellular thiol protease inhibitor. The protein is able to form a dimer stabilized by noncovalent forces, inhibiting papain and cathepsins l, h and b.

Molekulargewicht: 11 kDa (MW of target protein)

Pathways: Response to Water Deprivation