PSMB3 Antikörper

Produktnummer ABIN630921

Produktdetails anti-PSMB3 Antikörper

Target: PSMB3 (Proteasome Subunit beta 3 (PSMB3))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PSMB3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: PSMB3 antibody was raised using a synthetic peptide corresponding to a region with amino acids LNLYELKEGRQIKPYTLMSMVANLLYEKRFGPYYTEPVIAGLDPKTFKPF

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PSMB3 Blocking Peptide, catalog no. 33R-5230, is also available for use as a blocking control in assays to test for specificity of this PSMB3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PSMB3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PSMB3

Target: PSMB3 (Proteasome Subunit beta 3 (PSMB3))

Andere Bezeichnung: PSMB3 (PSMB3 Produkte)

Synonyme: HC10-II antikoerper, AL033320 antikoerper, C10-II antikoerper, PSB3 antikoerper, psmb3 antikoerper, wu:fb11d10 antikoerper, wu:fu88b08 antikoerper, zgc:56374 antikoerper, DDBDRAFT_0190542 antikoerper, DDBDRAFT_0232932 antikoerper, DDB_0190542 antikoerper, DDB_0232932 antikoerper, proteasome subunit beta 3 antikoerper, proteasome (prosome, macropain) subunit, beta type 3 antikoerper, proteasome subunit C10-11 antikoerper, proteasome subunit beta type-3 antikoerper, proteasome subunit beta 3 S homeolog antikoerper, 20S proteasome subunit beta-3 antikoerper, PSMB3 antikoerper, Psmb3 antikoerper, LOC100135869 antikoerper, LOC399377 antikoerper, psmb3.S antikoerper, psmb3 antikoerper, psmB3 antikoerper

Hintergrund: The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits, 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a member of the proteasome B-type family, also known as the T1B family, that is a 20S core beta subunit.

Molekulargewicht: 23 kDa (MW of target protein)

Pathways: Mitotic G1-G1/S Phases, DNA Replication, Synthesis of DNA, Cell RedoxHomeostasis, Lipid Metabolism