ACADS Antikörper (Middle Region)

Produktnummer ABIN630890

Produktdetails anti-ACADS Antikörper

Target: ACADS (Acads) (Acyl-CoA Dehydrogenase, C-2 To C-3 Short Chain (Acads))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ACADS Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: ACADS antibody was raised against the middle region of ACADS

Aufreinigung: Affinity purified

Immunogen: ACADS antibody was raised using the middle region of ACADS corresponding to a region with amino acids FTSGDKIGCFALSEPGNGSDAGAASTTARAEGDSWVLNGTKAWITNAWEA

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ACADS Blocking Peptide, catalog no. 33R-3100, is also available for use as a blocking control in assays to test for specificity of this ACADS antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACADS antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ACADS

Target: ACADS (Acads) (Acyl-CoA Dehydrogenase, C-2 To C-3 Short Chain (Acads))

Andere Bezeichnung: ACADS (Acads Produkte)

Synonyme: ACAD3 antikoerper, SCAD antikoerper, wu:fc44c01 antikoerper, zgc:92400 antikoerper, acad3 antikoerper, scad antikoerper, Scad antikoerper, AI196007 antikoerper, Bcd-1 antikoerper, Bcd1 antikoerper, Hdlq8 antikoerper, acyl-CoA dehydrogenase short chain antikoerper, acyl-CoA dehydrogenase, C-2 to C-3 short chain antikoerper, acyl-Coenzyme A dehydrogenase, C-2 to C-3 short chain antikoerper, acyl-CoA dehydrogenase, C-2 to C-3 short chain L homeolog antikoerper, acyl-Coenzyme A dehydrogenase, short chain antikoerper, ACADS antikoerper, acads antikoerper, Acads antikoerper, acads.L antikoerper

Hintergrund: ACADS is a a tetrameric mitochondrial flavoprotein, which is a member of the acyl-CoA dehydrogenase family. This enzyme catalyzes the initial step of the mitochondrial fatty acid beta-oxidation pathway. Mutations in this gene have been associated with Short Chain Acyl-CoA Dehydrogenase Deficiency. This gene encodes a a tetrameric mitochondrial flavoprotein, which is a member of the acyl-CoA dehydrogenase family. This enzyme catalyzes the initial step of the mitochondrial fatty acid beta-oxidation pathway. Mutations in this gene have been associated with Short Chain Acyl-CoA Dehydrogenase Deficiency.

Molekulargewicht: 42 kDa (MW of target protein)

Pathways: Monocarboxylic Acid Catabolic Process