DYNLL2 Antikörper (N-Term)

Produktnummer ABIN630885

Produktdetails anti-DYNLL2 Antikörper

Target: DYNLL2 (Dynein, Light Chain, LC8-Type 2 (DYNLL2))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte, C. elegans, Drosophila melanogaster

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser DYNLL2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: DYNLL2 antibody was raised against the N terminal of DYNLL2

Aufreinigung: Affinity purified

Immunogen: DYNLL2 antibody was raised using the N terminal of DYNLL2 corresponding to a region with amino acids MSDRKAVIKNADMSEDMQQDAVDCATQAMEKYNIEKDIAAYIKKEFDKKY

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

DYNLL2 Blocking Peptide, catalog no. 33R-6410, is also available for use as a blocking control in assays to test for specificity of this DYNLL2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DYNLL2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu DYNLL2

Target: DYNLL2 (Dynein, Light Chain, LC8-Type 2 (DYNLL2))

Andere Bezeichnung: DYNLL2 (DYNLL2 Produkte)

Synonyme: DNCL1B antikoerper, Dlc2 antikoerper, RSPH22 antikoerper, dlc2 antikoerper, dncl1b antikoerper, 1700064A15Rik antikoerper, 6720463E02Rik antikoerper, C87222 antikoerper, DLC8 antikoerper, DLC8b antikoerper, dynein light chain LC8-type 2 antikoerper, dynein light chain LC8-type 2 S homeolog antikoerper, DYNLL2 antikoerper, dynll2.S antikoerper, dynll2 antikoerper, Dynll2 antikoerper

Hintergrund: DYNLL2 belongs to the dynein light chain family. DYNLL2 may be involved in some aspects of dynein-related intracellular transport and motility. It may play a role in changing or maintaining the spatial distribution of cytoskeletal structures.

Molekulargewicht: 10 kDa (MW of target protein)

Pathways: M Phase