DYNLL2 Antikörper (N-Term)
-
- Target Alle DYNLL2 Antikörper anzeigen
- DYNLL2 (Dynein, Light Chain, LC8-Type 2 (DYNLL2))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Maus, Ratte, C. elegans, Drosophila melanogaster
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser DYNLL2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- DYNLL2 antibody was raised against the N terminal of DYNLL2
- Aufreinigung
- Affinity purified
- Immunogen
- DYNLL2 antibody was raised using the N terminal of DYNLL2 corresponding to a region with amino acids MSDRKAVIKNADMSEDMQQDAVDCATQAMEKYNIEKDIAAYIKKEFDKKY
- Top Product
- Discover our top product DYNLL2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
DYNLL2 Blocking Peptide, catalog no. 33R-6410, is also available for use as a blocking control in assays to test for specificity of this DYNLL2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DYNLL2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- DYNLL2 (Dynein, Light Chain, LC8-Type 2 (DYNLL2))
- Andere Bezeichnung
- DYNLL2 (DYNLL2 Produkte)
- Synonyme
- DNCL1B antikoerper, Dlc2 antikoerper, RSPH22 antikoerper, dlc2 antikoerper, dncl1b antikoerper, 1700064A15Rik antikoerper, 6720463E02Rik antikoerper, C87222 antikoerper, DLC8 antikoerper, DLC8b antikoerper, dynein light chain LC8-type 2 antikoerper, dynein light chain LC8-type 2 S homeolog antikoerper, DYNLL2 antikoerper, dynll2.S antikoerper, dynll2 antikoerper, Dynll2 antikoerper
- Hintergrund
- DYNLL2 belongs to the dynein light chain family. DYNLL2 may be involved in some aspects of dynein-related intracellular transport and motility. It may play a role in changing or maintaining the spatial distribution of cytoskeletal structures.
- Molekulargewicht
- 10 kDa (MW of target protein)
- Pathways
- M Phase
-