ADAMTS4 Antikörper (N-Term)

Produktnummer ABIN630877

Produktdetails anti-ADAMTS4 Antikörper

Target: ADAMTS4 (ADAM Metallopeptidase with Thrombospondin Type 1 Motif, 4 (ADAMTS4))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ADAMTS4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Spezifität: ADAMTS4 antibody was raised against the N terminal of ADAMTS4

Aufreinigung: Affinity purified

Immunogen: ADAMTS4 antibody was raised using the N terminal of ADAMTS4 corresponding to a region with amino acids GVQVEGLTVQYLGQAPELLGGAEPGTYLTGTINGDPESVASLHWDGGALL

Anwendungsinformationen

Applikationshinweise: WB: 0.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ADAMTS4 Blocking Peptide, catalog no. 33R-3654, is also available for use as a blocking control in assays to test for specificity of this ADAMTS4 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ADAMTS4 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ADAMTS4

Target: ADAMTS4 (ADAM Metallopeptidase with Thrombospondin Type 1 Motif, 4 (ADAMTS4))

Andere Bezeichnung: ADAMTS4 (ADAMTS4 Produkte)

Synonyme: 3830423K05 antikoerper, ADAM-TS4 antikoerper, ADAMTS-2 antikoerper, ADMP-1 antikoerper, mKIAA0688 antikoerper, ADAMTS-4 antikoerper, ADAMTS4 antikoerper, a disintegrin-like and metallopeptidase (reprolysin type) with thrombospondin type 1 motif, 4 antikoerper, ADAM metallopeptidase with thrombospondin type 1 motif 4 antikoerper, ADAM metallopeptidase with thrombospondin type 1 motif, 4 antikoerper, Adamts4 antikoerper, ADAMTS4 antikoerper

Hintergrund: ADAMTS4 is a member of the ADAMTS (a disintegrin and metalloproteinase with thrombospondin motifs) protein family. Members of the family share several distinct protein modules, including a propeptide region, a metalloproteinase domain, a disintegrin-like domain, and a thrombospondin type 1 (TS) motif. Individual members of this family differ in the number of C-terminal TS motifs, and some have unique C-terminal domains. ADAMTS4 lacks a C-terminal TS motif. It is responsible for the degradation of aggrecan, a major proteoglycan of cartilage, and brevican, a brain-specific extracellular matrix protein. The cleavage of aggrecan and brevican suggests key roles of this enzyme in arthritic disease and in the central nervous system, potentially, in the progression of glioma.

Molekulargewicht: 37 kDa (MW of target protein)