UPB1 Antikörper (Middle Region)
-
- Target Alle UPB1 Antikörper anzeigen
- UPB1 (Ureidopropionase, beta (UPB1))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser UPB1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- UPB1 antibody was raised against the middle region of UPB1
- Aufreinigung
- Affinity purified
- Immunogen
- UPB1 antibody was raised using the middle region of UPB1 corresponding to a region with amino acids NRVGTEHFPNEFTSGDGKKAHQDFGYFYGSSYVAAPDSSRTPGLSRSRDG
- Top Product
- Discover our top product UPB1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
UPB1 Blocking Peptide, catalog no. 33R-6866, is also available for use as a blocking control in assays to test for specificity of this UPB1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UPB1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- UPB1 (Ureidopropionase, beta (UPB1))
- Andere Bezeichnung
- UPB1 (UPB1 Produkte)
- Synonyme
- MGC82230 antikoerper, wu:fb69e03 antikoerper, zgc:64020 antikoerper, BUP1 antikoerper, AI195023 antikoerper, Bup1 antikoerper, ureidopropionase, beta S homeolog antikoerper, beta-ureidopropionase 1 antikoerper, ureidopropionase, beta antikoerper, UreidoPropionase Beta antikoerper, upb1.S antikoerper, UPB1 antikoerper, upb1 antikoerper, upb-1 antikoerper, Upb1 antikoerper
- Hintergrund
- UPB1 is a protein that belongs to the CN hydrolase family. Beta-ureidopropionase catalyzes the last step in the pyrimidine degradation pathway.
- Molekulargewicht
- 43 kDa (MW of target protein)
-