PIWIL4 Antikörper

Produktnummer ABIN630849

Produktdetails anti-PIWIL4 Antikörper

Target: PIWIL4 (Piwi-Like 4 (PIWIL4))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PIWIL4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: PIWIL4 antibody was raised using a synthetic peptide corresponding to a region with amino acids SGRARVKARGIARSPSATEVGRIQASPLPRSVDLSNNEASSSNGFLGTSR

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PIWIL4 Blocking Peptide, catalog no. 33R-8482, is also available for use as a blocking control in assays to test for specificity of this PIWIL4 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PIWIL4 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PIWIL4

Target: PIWIL4 (Piwi-Like 4 (PIWIL4))

Andere Bezeichnung: PIWIL4 (PIWIL4 Produkte)

Synonyme: HIWI2 antikoerper, MIWI2 antikoerper, 9230101H05Rik antikoerper, Miwi2 antikoerper, piwi like RNA-mediated gene silencing 4 antikoerper, piwi-like RNA-mediated gene silencing 4 antikoerper, PIWIL4 antikoerper, Piwil4 antikoerper

Hintergrund: PIWIL4 belongs to the Argonaute family of proteins, which function in development and maintenance of germline stem cells.

Molekulargewicht: 96 kDa (MW of target protein)