CSTB Antikörper
-
- Target Alle CSTB Antikörper anzeigen
- CSTB (Cystatin B (Stefin B) (CSTB))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser CSTB Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- Cystatin B antibody was raised using a synthetic peptide corresponding to a region with amino acids MMCGAPSATQPATAETQHIADQVRSQLEEKENKKFPVFKAVSFKSQVVAG
- Top Product
- Discover our top product CSTB Primärantikörper
-
-
- Applikationshinweise
-
WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
Cystatin B Blocking Peptide, catalog no. 33R-6226, is also available for use as a blocking control in assays to test for specificity of this Cystatin B antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CSTB antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CSTB (Cystatin B (Stefin B) (CSTB))
- Andere Bezeichnung
- Cystatin B (CSTB Produkte)
- Synonyme
- CST6 antikoerper, EPM1 antikoerper, EPM1A antikoerper, PME antikoerper, STFB antikoerper, ULD antikoerper, CSTB antikoerper, Cyb antikoerper, Epm1 antikoerper, Stfb antikoerper, MGC189005 antikoerper, pme antikoerper, cst6 antikoerper, epm1 antikoerper, stfb antikoerper, AA960480 antikoerper, ARABIDOPSIS THALIANA PHYTOCYSTATIN 6 antikoerper, ATCYS6 antikoerper, ATCYSB antikoerper, cystatin B antikoerper, LOC100008600 antikoerper, LOC100136235 antikoerper, CPI1 antikoerper, cystatin B antikoerper, cystatin B (stefin B) antikoerper, cystatin 14a, tandem duplicate 2 antikoerper, cystatin-B antikoerper, CSTB antikoerper, Cstb antikoerper, cstb antikoerper, cst14a.2 antikoerper, CYSB antikoerper, cpi1 antikoerper, LOC101123265 antikoerper
- Hintergrund
- CSTB is a stefin that functions as an intracellular thiol protease inhibitor. The protein is able to form a dimer stabilized by noncovalent forces, inhibiting papain and cathepsins l, h and b. The protein is thought to play a role in protecting against the proteases leaking from lysosomes. Evidence indicates that mutations in CSTB gene are responsible for the primary defects in patients with progressive myoclonic epilepsy a stefin that functions as an intracellular thiol protease inhibitor.
- Molekulargewicht
- 11 kDa (MW of target protein)
- Pathways
- Response to Water Deprivation
-