HSPH1 Antikörper (Middle Region)

Produktnummer ABIN630808

Produktdetails anti-HSPH1 Antikörper

Target: HSPH1 (Heat Shock 105kDa/110kDa Protein 1 (HSPH1))

Bindungsspezifität: Middle Region

Reaktivität: Human, Ratte, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser HSPH1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: HSPH1 antibody was raised against the middle region of HSPH1

Aufreinigung: Affinity purified

Immunogen: HSPH1 antibody was raised using the middle region of HSPH1 corresponding to a region with amino acids EENEMSSEADMECLNQRPPENPDTDKNVQQDNSEAGTQPQVQTDAQQTSQ

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

HSPH1 Blocking Peptide, catalog no. 33R-2377, is also available for use as a blocking control in assays to test for specificity of this HSPH1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HSPH1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu HSPH1

Target: HSPH1 (Heat Shock 105kDa/110kDa Protein 1 (HSPH1))

Andere Bezeichnung: HSPH1 (HSPH1 Produkte)

Synonyme: hsp105 antikoerper, hsp105a antikoerper, hsp105b antikoerper, hsp110 antikoerper, hsph1b antikoerper, Hsp105 antikoerper, HSP105 antikoerper, HSP105A antikoerper, HSP105B antikoerper, NY-CO-25 antikoerper, 105kDa antikoerper, AI790491 antikoerper, Hsp110 antikoerper, hsp-E7I antikoerper, hsph1 antikoerper, hsph1a antikoerper, heat shock protein family H (Hsp110) member 1 antikoerper, heat shock protein family H (Hsp110) member 1 S homeolog antikoerper, heat shock protein 105 kDa antikoerper, heat shock 105kDa/110kDa protein 1 antikoerper, heat shock protein family H (Hsp110) member 1 L homeolog antikoerper, hsph1 antikoerper, hsph1.S antikoerper, HSPH1 antikoerper, LOC100546590 antikoerper, Hsph1 antikoerper, hsph1.L antikoerper

Hintergrund: HSPH1 prevents the aggregation of denatured proteins in cells under severe stress, on which the ATP levels decrease markedly. It inhibits HSPA8/HSC70 ATPase and chaperone activities.

Molekulargewicht: 97 kDa (MW of target protein)