GABARAP Antikörper

Produktnummer ABIN630786

Produktdetails anti-GABARAP Antikörper

Target: GABARAP (GABA(A) Receptor-Associated Protein (GABARAP))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser GABARAP Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: GABARAP antibody was raised using a synthetic peptide corresponding to a region with amino acids KFVYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYLV

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

GABARAP Blocking Peptide, catalog no. 33R-4382, is also available for use as a blocking control in assays to test for specificity of this GABARAP antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GABARAP antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu GABARAP

Target: GABARAP (GABA(A) Receptor-Associated Protein (GABARAP))

Andere Bezeichnung: GABARAP (GABARAP Produkte)

Synonyme: GABARAP antikoerper, ATG8A antikoerper, GABARAP-a antikoerper, MM46 antikoerper, gabarap antikoerper, mg:bb02b03 antikoerper, GABA type A receptor-associated protein antikoerper, gamma-aminobutyric acid receptor-associated protein antikoerper, GABA(A) receptor-associated protein a antikoerper, gamma-aminobutyric acid receptor associated protein antikoerper, GABARAP antikoerper, LOC5568843 antikoerper, Gabarap antikoerper, gabarapa antikoerper

Hintergrund: Gamma-aminobutyric acid A receptors [GABA(A) receptors] are ligand-gated chloride channels that mediate inhibitory neurotransmission. GABA(A) receptor-associated protein (GABARAP) is highly positively charged in its N-terminus and shares sequence similarity with light chain-3 of microtubule-associated proteins 1A and 1B. This protein clusters neurotransmitter receptors by mediating interaction with the cytoskeleton.

Molekulargewicht: 14 kDa (MW of target protein)

Pathways: Autophagie