BLVRB Antikörper (Middle Region)

Produktnummer ABIN630752

Produktdetails anti-BLVRB Antikörper

Target: BLVRB (Flavin Reductase (BLVRB))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser BLVRB Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: BLVRB antibody was raised against the middle region of BLVRB

Aufreinigung: Affinity purified

Immunogen: BLVRB antibody was raised using the middle region of BLVRB corresponding to a region with amino acids GLKYVAVMPPHIGDQPLTGAYTVTLDGRGPSRVISKHDLGHFMLRCLTTD

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

BLVRB Blocking Peptide, catalog no. 33R-3403, is also available for use as a blocking control in assays to test for specificity of this BLVRB antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BLVRB antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu BLVRB

Target: BLVRB (Flavin Reductase (BLVRB))

Andere Bezeichnung: BLVRB (BLVRB Produkte)

Synonyme: BVRB antikoerper, FLR antikoerper, SDR43U1 antikoerper, biliverdin reductase B (flavin reductase (NADPH)) antikoerper, biliverdin reductase B antikoerper, Blvrb antikoerper, BLVRB antikoerper

Hintergrund: BLVRB catalyzes electron transfer from reduced pyridine nucleotides to flavins as well as methylene blue, pyrroloquinoline quinone, riboflavin, or methemoglobin. BLVRB has possible role in protecting cells from oxidative damage or in regulating iron metabolism. In the liver, BLVRB converts biliverdin to bilirubin.

Molekulargewicht: 22 kDa (MW of target protein)