BLVRB Antikörper (Middle Region)
-
- Target Alle BLVRB Antikörper anzeigen
- BLVRB (Flavin Reductase (BLVRB))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser BLVRB Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- BLVRB antibody was raised against the middle region of BLVRB
- Aufreinigung
- Affinity purified
- Immunogen
- BLVRB antibody was raised using the middle region of BLVRB corresponding to a region with amino acids GLKYVAVMPPHIGDQPLTGAYTVTLDGRGPSRVISKHDLGHFMLRCLTTD
- Top Product
- Discover our top product BLVRB Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
BLVRB Blocking Peptide, catalog no. 33R-3403, is also available for use as a blocking control in assays to test for specificity of this BLVRB antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BLVRB antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- BLVRB (Flavin Reductase (BLVRB))
- Andere Bezeichnung
- BLVRB (BLVRB Produkte)
- Synonyme
- BVRB antikoerper, FLR antikoerper, SDR43U1 antikoerper, biliverdin reductase B (flavin reductase (NADPH)) antikoerper, biliverdin reductase B antikoerper, Blvrb antikoerper, BLVRB antikoerper
- Hintergrund
- BLVRB catalyzes electron transfer from reduced pyridine nucleotides to flavins as well as methylene blue, pyrroloquinoline quinone, riboflavin, or methemoglobin. BLVRB has possible role in protecting cells from oxidative damage or in regulating iron metabolism. In the liver, BLVRB converts biliverdin to bilirubin.
- Molekulargewicht
- 22 kDa (MW of target protein)
-