QTRT1 Antikörper

Produktnummer ABIN630737

Der Kaninchen Polyklonal anti-QTRT1 Antikörper wird verwendet zum Nachweis von QTRT1 in Proben von Human, Maus und Ratte. Er wurde validiert für WB.

Kurzübersicht für QTRT1 Antikörper (ABIN630737)

Target: QTRT1 (Queuine tRNA-Ribosyltransferase 1 (QTRT1))

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser QTRT1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-QTRT1 Antikörper

Aufreinigung: Affinity purified

Immunogen: QTRT1 antibody was raised using a synthetic peptide corresponding to a region with amino acids KDKPRYLMGVGYATDLVVCVALGCDMFDCVFPTRTARFGSALVPTGNLQL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

QTRT1 Blocking Peptide, (ABIN939676), is also available for use as a blocking control in assays to test for specificity of this QTRT1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of QTRT1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu QTRT1

Target: QTRT1 (Queuine tRNA-Ribosyltransferase 1 (QTRT1))

Andere Bezeichnung: QTRT1

Hintergrund: TRNA-guanine transglycosylase synthesizes queuosine (Q), which is found in tRNAs that recognise NAU and NAC codons, encoding tyr, asn, asp, and his. Prokaryotic TGT is a single protein of 43 kDa. In contrast, mammalian TGT appears to be a heterodimer consisting of a 60 kDa subunit and a 43 kDa catalytic subunit.

Molekulargewicht: 44 kDa (MW of target protein)

Pathways: Ribonucleoside Biosynthetic Process