QTRT1 Antikörper
-
- Target Alle QTRT1 Antikörper anzeigen
- QTRT1 (Queuine tRNA-Ribosyltransferase 1 (QTRT1))
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser QTRT1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- QTRT1 antibody was raised using a synthetic peptide corresponding to a region with amino acids KDKPRYLMGVGYATDLVVCVALGCDMFDCVFPTRTARFGSALVPTGNLQL
- Top Product
- Discover our top product QTRT1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
QTRT1 Blocking Peptide, catalog no. 33R-4290, is also available for use as a blocking control in assays to test for specificity of this QTRT1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of QTRT1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- QTRT1 (Queuine tRNA-Ribosyltransferase 1 (QTRT1))
- Andere Bezeichnung
- QTRT1 (QTRT1 Produkte)
- Synonyme
- CG4947 antikoerper, Dmel\\CG4947 antikoerper, TGT antikoerper, tgt antikoerper, zgc:66378 antikoerper, FP3235 antikoerper, TGUT antikoerper, 2610028E17Rik antikoerper, Tgt antikoerper, Tgut antikoerper, tRNA-guanine transglycosylase antikoerper, queuine tRNA-ribosyltransferase 1 S homeolog antikoerper, queuine tRNA-ribosyltransferase 1 antikoerper, queuine tRNA-ribosyltransferase catalytic subunit 1 antikoerper, Tgt antikoerper, Olsu_0732 antikoerper, Palpr_1298 antikoerper, Riean_1227 antikoerper, Calni_1240 antikoerper, Ftrac_0312 antikoerper, Ocepr_1541 antikoerper, Sulku_0977 antikoerper, Tmar_0854 antikoerper, Bache_2323 antikoerper, Nitsa_1291 antikoerper, Isop_1657 antikoerper, Despr_0021 antikoerper, Pedsa_1842 antikoerper, Corgl_1148 antikoerper, Mahau_0921 antikoerper, Theth_0831 antikoerper, qtrt1.S antikoerper, qtrt1 antikoerper, QTRT1 antikoerper, Qtrt1 antikoerper
- Hintergrund
- TRNA-guanine transglycosylase synthesizes queuosine (Q), which is found in tRNAs that recognise NAU and NAC codons, encoding tyr, asn, asp, and his. Prokaryotic TGT is a single protein of 43 kDa. In contrast, mammalian TGT appears to be a heterodimer consisting of a 60 kDa subunit and a 43 kDa catalytic subunit.
- Molekulargewicht
- 44 kDa (MW of target protein)
- Pathways
- Ribonucleoside Biosynthetic Process
-