MORC3 Antikörper (N-Term)

Produktnummer ABIN630711

Produktdetails anti-MORC3 Antikörper

Target: MORC3 (MORC Family CW-Type Zinc Finger 3 (MORC3))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MORC3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: MORC3 antibody was raised against the N terminal of MORC3

Aufreinigung: Affinity purified

Immunogen: MORC3 antibody was raised using the N terminal of MORC3 corresponding to a region with amino acids KLLAELDAIIGKKGTRIIIWNLRSYKNATEFDFEKDKYDIRIPEDLDEIT

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

MORC3 Blocking Peptide, catalog no. 33R-4516, is also available for use as a blocking control in assays to test for specificity of this MORC3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MORC3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu MORC3

Target: MORC3 (MORC Family CW-Type Zinc Finger 3 (MORC3))

Andere Bezeichnung: MORC3 (MORC3 Produkte)

Synonyme: NXP2 antikoerper, ZCW5 antikoerper, ZCWCC3 antikoerper, 1110051N18Rik antikoerper, AI452146 antikoerper, BF318192 antikoerper, D16Jhu32e antikoerper, Zcwcc3 antikoerper, sb:cb561 antikoerper, sb:cb69 antikoerper, zgc:101052 antikoerper, fb73c08 antikoerper, wu:fb73c08 antikoerper, zgc:162471 antikoerper, morc3 antikoerper, MORC family CW-type zinc finger 3 antikoerper, microrchidia 3 antikoerper, MORC family CW-type zinc finger 3b antikoerper, MORC family CW-type zinc finger 3a antikoerper, MORC family CW-type zinc finger 3 S homeolog antikoerper, MORC3 antikoerper, Morc3 antikoerper, morc3b antikoerper, morc3a antikoerper, morc3.S antikoerper

Hintergrund: MORC3 localizes to the nuclear matrix. Also, MORC3 has RNA binding activity, and has a predicted coiled-coil domain. The protein also has RNA binding activity, and has a predicted coiled-coil domain.

Molekulargewicht: 107 kDa (MW of target protein)

Pathways: Maintenance of Protein Location