H2AFY Antikörper (N-Term)
-
- Target Alle H2AFY Antikörper anzeigen
- H2AFY (H2A Histone Family, Member Y (H2AFY))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser H2AFY Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- H2 AFY antibody was raised against the N terminal of H2 FY
- Aufreinigung
- Affinity purified
- Immunogen
- H2 AFY antibody was raised using the N terminal of H2 FY corresponding to a region with amino acids MSSRGGKKKSTKTSRSAKAGVIFPVGRMLRYIKKGHPKYRIGVGAPVYMA
- Top Product
- Discover our top product H2AFY Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
H2AFY Blocking Peptide, catalog no. 33R-6507, is also available for use as a blocking control in assays to test for specificity of this H2AFY antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of H0 FY antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- H2AFY (H2A Histone Family, Member Y (H2AFY))
- Andere Bezeichnung
- H2AFY (H2AFY Produkte)
- Synonyme
- H2A.y antikoerper, H2A/y antikoerper, H2AF12M antikoerper, H2AFJ antikoerper, MACROH2A1.1 antikoerper, mH2A1 antikoerper, macroH2A1.2 antikoerper, mH2a1 antikoerper, macroH2A1 antikoerper, wu:fa93c12 antikoerper, zgc:136891 antikoerper, h2a.y antikoerper, h2a/y antikoerper, h2af12m antikoerper, h2afj antikoerper, macroh2a antikoerper, mh2a1 antikoerper, core histone macro-H2A.1 antikoerper, H2A histone family, member Y antikoerper, H2A histone family member Y antikoerper, H2A histone family member Y L homeolog antikoerper, LOC100230612 antikoerper, H2AFY antikoerper, LOC481514 antikoerper, H2afy antikoerper, h2afy antikoerper, h2afy.L antikoerper
- Hintergrund
- Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes.
- Molekulargewicht
- 41 kDa (MW of target protein)
-