H2AFY Antikörper (N-Term)

Produktnummer ABIN630699

Der Kaninchen Polyklonal anti-H2AFY Antikörper (ABIN630699) detektiert spezifisch H2AFY in WB. Dieser Antikörper reagiert spezifisch mit Proben aus Human.

Kurzübersicht für H2AFY Antikörper (N-Term) (ABIN630699)

Target: H2AFY (H2A Histone Family, Member Y (H2AFY))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser H2AFY Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Produktdetails anti-H2AFY Antikörper

Bindungsspezifität: N-Term

Spezifität: H2 AFY antibody was raised against the N terminal of H2 FY

Aufreinigung: Affinity purified

Immunogen: H2 AFY antibody was raised using the N terminal of H2 FY corresponding to a region with amino acids MSSRGGKKKSTKTSRSAKAGVIFPVGRMLRYIKKGHPKYRIGVGAPVYMA

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

H2AFY Blocking Peptide, (ABIN5613916), is also available for use as a blocking control in assays to test for specificity of this H2AFY antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of H0 FY antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu H2AFY

Target: H2AFY (H2A Histone Family, Member Y (H2AFY))

Andere Bezeichnung: H2AFY

Hintergrund: Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes.

Molekulargewicht: 41 kDa (MW of target protein)