H2AFY Antikörper (N-Term)

Produktnummer ABIN630699

Produktdetails anti-H2AFY Antikörper

Target: H2AFY (H2A Histone Family, Member Y (H2AFY))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser H2AFY Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: H2 AFY antibody was raised against the N terminal of H2 FY

Aufreinigung: Affinity purified

Immunogen: H2 AFY antibody was raised using the N terminal of H2 FY corresponding to a region with amino acids MSSRGGKKKSTKTSRSAKAGVIFPVGRMLRYIKKGHPKYRIGVGAPVYMA

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

H2AFY Blocking Peptide, catalog no. 33R-6507, is also available for use as a blocking control in assays to test for specificity of this H2AFY antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of H0 FY antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu H2AFY

Target: H2AFY (H2A Histone Family, Member Y (H2AFY))

Andere Bezeichnung: H2AFY (H2AFY Produkte)

Synonyme: H2A.y antikoerper, H2A/y antikoerper, H2AF12M antikoerper, H2AFJ antikoerper, MACROH2A1.1 antikoerper, mH2A1 antikoerper, macroH2A1.2 antikoerper, mH2a1 antikoerper, macroH2A1 antikoerper, wu:fa93c12 antikoerper, zgc:136891 antikoerper, h2a.y antikoerper, h2a/y antikoerper, h2af12m antikoerper, h2afj antikoerper, macroh2a antikoerper, mh2a1 antikoerper, core histone macro-H2A.1 antikoerper, H2A histone family, member Y antikoerper, H2A histone family member Y antikoerper, H2A histone family member Y L homeolog antikoerper, LOC100230612 antikoerper, H2AFY antikoerper, LOC481514 antikoerper, H2afy antikoerper, h2afy antikoerper, h2afy.L antikoerper

Hintergrund: Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes.

Molekulargewicht: 41 kDa (MW of target protein)