STRADA Antikörper (C-Term)

Produktnummer ABIN630667

Produktdetails anti-STRADA Antikörper

Target: STRADA (STE20-Related Kinase Adaptor alpha (STRADA))

Bindungsspezifität: C-Term

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser STRADA Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: LYK5 antibody was raised against the C terminal of LYK5

Aufreinigung: Affinity purified

Immunogen: LYK5 antibody was raised using the C terminal of LYK5 corresponding to a region with amino acids AEELTMSPSRSVANSGLSDSLTTSTPRPSNGDSPSHPYHRTFSPHFHHFV

Anwendungsinformationen

Applikationshinweise: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

LYK5 Blocking Peptide, catalog no. 33R-1125, is also available for use as a blocking control in assays to test for specificity of this LYK5 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LYK5 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu STRADA

Target: STRADA (STE20-Related Kinase Adaptor alpha (STRADA))

Andere Bezeichnung: LYK5 (STRADA Produkte)

Synonyme: fj99g05 antikoerper, zgc:56109 antikoerper, wu:fj99g05 antikoerper, lyk5 antikoerper, LYK5 antikoerper, NY-BR-96 antikoerper, PMSE antikoerper, STRAD antikoerper, Stlk antikoerper, Lyk5 antikoerper, 2610019A05Rik antikoerper, 6030402H20Rik antikoerper, AI480680 antikoerper, E130112C09Rik antikoerper, STE20-related kinase adaptor alpha antikoerper, ste20-related kinase adaptor alpha antikoerper, STRADA antikoerper, strada antikoerper, Strada antikoerper

Hintergrund: LYK5 belongs to the protein kinase superfamily, STE Ser/Thr protein kinase family, STE20 subfamily. It contains 1 protein kinase domain. LYK5 is a pseudokinase which, in complex with CAB39, binds to and activates STK11.

Molekulargewicht: 44 kDa (MW of target protein)

Pathways: AMPK Signaling